Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABKQ09_RS15745 Genome accession   NZ_CP166870
Coordinates   3135969..3136112 (-) Length   47 a.a.
NCBI ID   WP_003327149.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain F4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3130969..3141112
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABKQ09_RS15720 (ABKQ09_15715) - 3131326..3131706 (-) 381 WP_371176080.1 hotdog fold thioesterase -
  ABKQ09_RS15725 (ABKQ09_15720) comA 3131724..3132365 (-) 642 WP_003327154.1 response regulator transcription factor Regulator
  ABKQ09_RS15730 (ABKQ09_15725) comP 3132446..3134740 (-) 2295 WP_268532909.1 histidine kinase Regulator
  ABKQ09_RS15735 (ABKQ09_15730) - 3134748..3134909 (-) 162 WP_061669362.1 competence pheromone ComX -
  ABKQ09_RS15740 (ABKQ09_15735) - 3134925..3135785 (-) 861 WP_061669434.1 polyprenyl synthetase family protein -
  ABKQ09_RS15745 (ABKQ09_15740) degQ 3135969..3136112 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  ABKQ09_RS15750 (ABKQ09_15745) - 3136572..3136931 (+) 360 WP_106033956.1 hypothetical protein -
  ABKQ09_RS15755 (ABKQ09_15750) - 3136950..3138182 (-) 1233 WP_003327147.1 EAL and HDOD domain-containing protein -
  ABKQ09_RS15760 (ABKQ09_15755) - 3138320..3139786 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -
  ABKQ09_RS15765 (ABKQ09_15760) - 3139802..3140353 (-) 552 WP_371176081.1 cysteine hydrolase family protein -
  ABKQ09_RS15770 (ABKQ09_15765) - 3140461..3140859 (-) 399 WP_003327144.1 YueI family protein -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5645.61 Da        Isoelectric Point: 8.5787

>NTDB_id=1035780 ABKQ09_RS15745 WP_003327149.1 3135969..3136112(-) (degQ) [Bacillus atrophaeus strain F4]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 144 bp        

>NTDB_id=1035780 ABKQ09_RS15745 WP_003327149.1 3135969..3136112(-) (degQ) [Bacillus atrophaeus strain F4]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.455

93.617

0.894

Multiple sequence alignment