Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ABKQ09_RS02190 Genome accession   NZ_CP166870
Coordinates   448759..448878 (+) Length   39 a.a.
NCBI ID   WP_004430266.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain F4     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 443759..453878
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABKQ09_RS02165 (ABKQ09_02165) - 443926..444675 (+) 750 WP_061669565.1 amino acid ABC transporter ATP-binding protein -
  ABKQ09_RS02170 (ABKQ09_02170) - 444691..445842 (+) 1152 WP_061669566.1 M20 peptidase aminoacylase family protein -
  ABKQ09_RS02175 (ABKQ09_02175) - 445839..447182 (+) 1344 WP_061669567.1 MmgE/PrpD family protein -
  ABKQ09_RS02180 (ABKQ09_02180) - 447223..447432 (+) 210 Protein_396 ATP-binding protein -
  ABKQ09_RS02185 (ABKQ09_02185) rapC 447627..448775 (+) 1149 WP_061669569.1 Rap family tetratricopeptide repeat protein Regulator
  ABKQ09_RS02190 (ABKQ09_02190) phrC 448759..448878 (+) 120 WP_004430266.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ABKQ09_RS02195 (ABKQ09_02195) - 449013..449120 (-) 108 WP_072053240.1 YjcZ family sporulation protein -
  ABKQ09_RS02200 (ABKQ09_02200) - 449324..449407 (-) 84 WP_371176570.1 YjcZ family sporulation protein -
  ABKQ09_RS02205 (ABKQ09_02205) - 449538..450902 (-) 1365 WP_061669570.1 aspartate kinase -
  ABKQ09_RS02210 (ABKQ09_02210) ceuB 451335..452285 (+) 951 WP_010789705.1 ABC transporter permease Machinery gene
  ABKQ09_RS02215 (ABKQ09_02215) - 452278..453225 (+) 948 WP_004430269.1 iron chelate uptake ABC transporter family permease subunit -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4111.89 Da        Isoelectric Point: 7.9858

>NTDB_id=1035726 ABKQ09_RS02190 WP_004430266.1 448759..448878(+) (phrC) [Bacillus atrophaeus strain F4]
MKLKSKLLIICLAAAAVFATVGVSNAEAPDYQVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1035726 ABKQ09_RS02190 WP_004430266.1 448759..448878(+) (phrC) [Bacillus atrophaeus strain F4]
ATGAAATTGAAATCTAAATTGCTCATTATTTGTTTGGCTGCAGCTGCTGTGTTTGCAACAGTTGGAGTGTCCAATGCTGA
AGCGCCTGATTATCAGGTGACAGAAAGAGGAATGACGTAA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769

Multiple sequence alignment