Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   AB3239_RS16750 Genome accession   NZ_CP166831
Coordinates   3200748..3200915 (-) Length   55 a.a.
NCBI ID   WP_038828676.1    Uniprot ID   I2D9X2
Organism   Bacillus subtilis strain TE3T-UV25     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3195748..3205915
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3239_RS16720 (AB3239_16720) mrpE 3196143..3196619 (+) 477 WP_021480495.1 Na+/H+ antiporter subunit E -
  AB3239_RS16725 (AB3239_16725) mrpF 3196619..3196903 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  AB3239_RS16730 (AB3239_16730) mnhG 3196887..3197261 (+) 375 WP_014477830.1 monovalent cation/H(+) antiporter subunit G -
  AB3239_RS16735 (AB3239_16735) yuxO 3197300..3197680 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  AB3239_RS16740 (AB3239_16740) comA 3197699..3198343 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AB3239_RS16745 (AB3239_16745) comP 3198424..3200733 (-) 2310 WP_038828679.1 two-component system sensor histidine kinase ComP Regulator
  AB3239_RS16750 (AB3239_16750) comX 3200748..3200915 (-) 168 WP_038828676.1 competence pheromone ComX Regulator
  AB3239_RS16755 (AB3239_16755) comQ 3200903..3201802 (-) 900 WP_038828674.1 class 1 isoprenoid biosynthesis enzyme Regulator
  AB3239_RS16760 (AB3239_16760) degQ 3201987..3202127 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AB3239_RS16765 (AB3239_16765) - 3202349..3202411 (+) 63 Protein_3237 hypothetical protein -
  AB3239_RS16770 (AB3239_16770) - 3202589..3202957 (+) 369 WP_038828672.1 hypothetical protein -
  AB3239_RS16775 (AB3239_16775) pdeH 3202933..3204162 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AB3239_RS16780 (AB3239_16780) pncB 3204299..3205771 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6561.45 Da        Isoelectric Point: 4.5668

>NTDB_id=1035554 AB3239_RS16750 WP_038828676.1 3200748..3200915(-) (comX) [Bacillus subtilis strain TE3T-UV25]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYRADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1035554 AB3239_RS16750 WP_038828676.1 3200748..3200915(-) (comX) [Bacillus subtilis strain TE3T-UV25]
GTGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATTGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCGGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2D9X2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

98.182

100

0.982


Multiple sequence alignment