Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AB6A22_RS11855 Genome accession   NZ_CP166297
Coordinates   2508162..2508539 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain FCW119-1M2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2503162..2513539
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6A22_RS11815 (AB6A22_11835) - 2503661..2504455 (+) 795 WP_003153106.1 YqhG family protein -
  AB6A22_RS11820 (AB6A22_11840) sinI 2504632..2504805 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB6A22_RS11825 (AB6A22_11845) sinR 2504839..2505174 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB6A22_RS11830 (AB6A22_11850) tasA 2505222..2506007 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  AB6A22_RS11835 (AB6A22_11855) sipW 2506071..2506655 (-) 585 WP_012117977.1 signal peptidase I SipW -
  AB6A22_RS11840 (AB6A22_11860) tapA 2506627..2507298 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  AB6A22_RS11845 (AB6A22_11865) - 2507557..2507886 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  AB6A22_RS11850 (AB6A22_11870) - 2507926..2508105 (-) 180 WP_003153093.1 YqzE family protein -
  AB6A22_RS11855 (AB6A22_11875) comGG 2508162..2508539 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB6A22_RS11860 (AB6A22_11880) comGF 2508540..2508935 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  AB6A22_RS11865 (AB6A22_11885) comGE 2508949..2509263 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  AB6A22_RS11870 (AB6A22_11890) comGD 2509247..2509684 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB6A22_RS11875 (AB6A22_11895) comGC 2509674..2509940 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  AB6A22_RS11880 (AB6A22_11900) comGB 2509987..2511024 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB6A22_RS11885 (AB6A22_11905) comGA 2511011..2512081 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AB6A22_RS11890 (AB6A22_11910) - 2512273..2513223 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=1034060 AB6A22_RS11855 WP_014305410.1 2508162..2508539(-) (comGG) [Bacillus velezensis strain FCW119-1M2]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1034060 AB6A22_RS11855 WP_014305410.1 2508162..2508539(-) (comGG) [Bacillus velezensis strain FCW119-1M2]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment