Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB6A22_RS11820 Genome accession   NZ_CP166297
Coordinates   2504632..2504805 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain FCW119-1M2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2499632..2509805
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6A22_RS11805 (AB6A22_11825) gcvT 2500449..2501549 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  AB6A22_RS11810 (AB6A22_11830) - 2501973..2503643 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  AB6A22_RS11815 (AB6A22_11835) - 2503661..2504455 (+) 795 WP_003153106.1 YqhG family protein -
  AB6A22_RS11820 (AB6A22_11840) sinI 2504632..2504805 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB6A22_RS11825 (AB6A22_11845) sinR 2504839..2505174 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB6A22_RS11830 (AB6A22_11850) tasA 2505222..2506007 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  AB6A22_RS11835 (AB6A22_11855) sipW 2506071..2506655 (-) 585 WP_012117977.1 signal peptidase I SipW -
  AB6A22_RS11840 (AB6A22_11860) tapA 2506627..2507298 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  AB6A22_RS11845 (AB6A22_11865) - 2507557..2507886 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  AB6A22_RS11850 (AB6A22_11870) - 2507926..2508105 (-) 180 WP_003153093.1 YqzE family protein -
  AB6A22_RS11855 (AB6A22_11875) comGG 2508162..2508539 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB6A22_RS11860 (AB6A22_11880) comGF 2508540..2508935 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  AB6A22_RS11865 (AB6A22_11885) comGE 2508949..2509263 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  AB6A22_RS11870 (AB6A22_11890) comGD 2509247..2509684 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1034058 AB6A22_RS11820 WP_003153105.1 2504632..2504805(+) (sinI) [Bacillus velezensis strain FCW119-1M2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1034058 AB6A22_RS11820 WP_003153105.1 2504632..2504805(+) (sinI) [Bacillus velezensis strain FCW119-1M2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment