Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB6A22_RS11820 | Genome accession | NZ_CP166297 |
| Coordinates | 2504632..2504805 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain FCW119-1M2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2499632..2509805
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB6A22_RS11805 (AB6A22_11825) | gcvT | 2500449..2501549 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB6A22_RS11810 (AB6A22_11830) | - | 2501973..2503643 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| AB6A22_RS11815 (AB6A22_11835) | - | 2503661..2504455 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| AB6A22_RS11820 (AB6A22_11840) | sinI | 2504632..2504805 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB6A22_RS11825 (AB6A22_11845) | sinR | 2504839..2505174 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB6A22_RS11830 (AB6A22_11850) | tasA | 2505222..2506007 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| AB6A22_RS11835 (AB6A22_11855) | sipW | 2506071..2506655 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| AB6A22_RS11840 (AB6A22_11860) | tapA | 2506627..2507298 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB6A22_RS11845 (AB6A22_11865) | - | 2507557..2507886 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| AB6A22_RS11850 (AB6A22_11870) | - | 2507926..2508105 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB6A22_RS11855 (AB6A22_11875) | comGG | 2508162..2508539 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB6A22_RS11860 (AB6A22_11880) | comGF | 2508540..2508935 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| AB6A22_RS11865 (AB6A22_11885) | comGE | 2508949..2509263 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AB6A22_RS11870 (AB6A22_11890) | comGD | 2509247..2509684 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1034058 AB6A22_RS11820 WP_003153105.1 2504632..2504805(+) (sinI) [Bacillus velezensis strain FCW119-1M2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1034058 AB6A22_RS11820 WP_003153105.1 2504632..2504805(+) (sinI) [Bacillus velezensis strain FCW119-1M2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |