Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB8O67_RS16975 Genome accession   NZ_CP166053
Coordinates   3236517..3236657 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain XYK2-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3231517..3241657
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB8O67_RS16950 (AB8O67_16945) - 3231829..3232209 (-) 381 WP_193659646.1 hotdog fold thioesterase -
  AB8O67_RS16955 (AB8O67_16950) comA 3232227..3232871 (-) 645 WP_024122680.1 two-component system response regulator ComA Regulator
  AB8O67_RS16960 (AB8O67_16955) comP 3232952..3235261 (-) 2310 WP_326140001.1 two-component system sensor histidine kinase ComP Regulator
  AB8O67_RS16965 (AB8O67_16960) comX 3235277..3235444 (-) 168 WP_326140022.1 competence pheromone ComX Regulator
  AB8O67_RS16970 (AB8O67_16965) comQ 3235428..3236333 (-) 906 WP_326140023.1 polyprenyl synthetase family protein Regulator
  AB8O67_RS16975 (AB8O67_16970) degQ 3236517..3236657 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  AB8O67_RS16980 (AB8O67_16975) - 3237118..3237486 (+) 369 WP_044158947.1 hypothetical protein -
  AB8O67_RS16985 (AB8O67_16980) - 3237462..3238691 (-) 1230 WP_059334756.1 EAL and HDOD domain-containing protein -
  AB8O67_RS16990 (AB8O67_16985) - 3238827..3240296 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  AB8O67_RS16995 (AB8O67_16990) - 3240312..3240863 (-) 552 WP_044158950.1 cysteine hydrolase family protein -
  AB8O67_RS17000 (AB8O67_16995) - 3240960..3241358 (-) 399 WP_326140002.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1033225 AB8O67_RS16975 WP_024122683.1 3236517..3236657(-) (degQ) [Bacillus halotolerans strain XYK2-4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1033225 AB8O67_RS16975 WP_024122683.1 3236517..3236657(-) (degQ) [Bacillus halotolerans strain XYK2-4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978

Multiple sequence alignment