Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   AB8O67_RS16965 Genome accession   NZ_CP166053
Coordinates   3235277..3235444 (-) Length   55 a.a.
NCBI ID   WP_326140022.1    Uniprot ID   -
Organism   Bacillus halotolerans strain XYK2-4     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3230277..3240444
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB8O67_RS16935 (AB8O67_16930) - 3230672..3231148 (+) 477 WP_044158941.1 Na+/H+ antiporter subunit E -
  AB8O67_RS16940 (AB8O67_16935) - 3231148..3231432 (+) 285 WP_024122677.1 Na(+)/H(+) antiporter subunit F1 -
  AB8O67_RS16945 (AB8O67_16940) mnhG 3231416..3231790 (+) 375 WP_059292644.1 monovalent cation/H(+) antiporter subunit G -
  AB8O67_RS16950 (AB8O67_16945) - 3231829..3232209 (-) 381 WP_193659646.1 hotdog fold thioesterase -
  AB8O67_RS16955 (AB8O67_16950) comA 3232227..3232871 (-) 645 WP_024122680.1 two-component system response regulator ComA Regulator
  AB8O67_RS16960 (AB8O67_16955) comP 3232952..3235261 (-) 2310 WP_326140001.1 two-component system sensor histidine kinase ComP Regulator
  AB8O67_RS16965 (AB8O67_16960) comX 3235277..3235444 (-) 168 WP_326140022.1 competence pheromone ComX Regulator
  AB8O67_RS16970 (AB8O67_16965) comQ 3235428..3236333 (-) 906 WP_326140023.1 polyprenyl synthetase family protein Regulator
  AB8O67_RS16975 (AB8O67_16970) degQ 3236517..3236657 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  AB8O67_RS16980 (AB8O67_16975) - 3237118..3237486 (+) 369 WP_044158947.1 hypothetical protein -
  AB8O67_RS16985 (AB8O67_16980) - 3237462..3238691 (-) 1230 WP_059334756.1 EAL and HDOD domain-containing protein -
  AB8O67_RS16990 (AB8O67_16985) - 3238827..3240296 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6417.22 Da        Isoelectric Point: 4.5844

>NTDB_id=1033223 AB8O67_RS16965 WP_326140022.1 3235277..3235444(-) (comX) [Bacillus halotolerans strain XYK2-4]
MQDLINYFLSYPEVLKKLKNKEACLIGFSSDETETIIKAYNDYHLSSPTTREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1033223 AB8O67_RS16965 WP_326140022.1 3235277..3235444(-) (comX) [Bacillus halotolerans strain XYK2-4]
ATGCAAGACCTAATTAACTACTTTTTAAGTTATCCTGAGGTTTTGAAAAAATTGAAAAATAAAGAAGCTTGCCTTATAGG
TTTTAGTTCAGACGAAACTGAAACAATAATAAAAGCTTACAATGATTATCATCTGTCTAGCCCAACAACCCGTGAATGGG
ATGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

81.132

96.364

0.782

Multiple sequence alignment