Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   JNUCC21_RS13130 Genome accession   NZ_CP166019
Coordinates   2641235..2641672 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus sp. JNUCC-21     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2636235..2646672
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNUCC21_RS13080 (JNUCC21_13110) sinI 2636618..2636791 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JNUCC21_RS13085 (JNUCC21_13115) sinR 2636825..2637160 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JNUCC21_RS13090 (JNUCC21_13120) tasA 2637208..2637993 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  JNUCC21_RS13095 (JNUCC21_13125) sipW 2638058..2638642 (-) 585 WP_015240205.1 signal peptidase I SipW -
  JNUCC21_RS13100 (JNUCC21_13130) tapA 2638614..2639285 (-) 672 WP_150941310.1 amyloid fiber anchoring/assembly protein TapA -
  JNUCC21_RS13105 (JNUCC21_13135) - 2639544..2639873 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JNUCC21_RS13110 (JNUCC21_13140) - 2639914..2640093 (-) 180 WP_003153093.1 YqzE family protein -
  JNUCC21_RS13115 (JNUCC21_13145) comGG 2640150..2640527 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  JNUCC21_RS13120 (JNUCC21_13150) comGF 2640528..2641028 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  JNUCC21_RS13125 (JNUCC21_13155) comGE 2640937..2641251 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  JNUCC21_RS13130 (JNUCC21_13160) comGD 2641235..2641672 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  JNUCC21_RS13135 (JNUCC21_13165) comGC 2641662..2641970 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  JNUCC21_RS13140 (JNUCC21_13170) comGB 2641975..2643012 (-) 1038 WP_218791295.1 competence type IV pilus assembly protein ComGB Machinery gene
  JNUCC21_RS13145 (JNUCC21_13175) comGA 2642999..2644069 (-) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  JNUCC21_RS13150 (JNUCC21_13180) - 2644262..2645212 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  JNUCC21_RS13155 (JNUCC21_13185) - 2645358..2646659 (+) 1302 WP_369878206.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=1033126 JNUCC21_RS13130 WP_007612572.1 2641235..2641672(-) (comGD) [Bacillus sp. JNUCC-21]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1033126 JNUCC21_RS13130 WP_007612572.1 2641235..2641672(-) (comGD) [Bacillus sp. JNUCC-21]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAGCAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment