Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | JNUCC21_RS13080 | Genome accession | NZ_CP166019 |
| Coordinates | 2636618..2636791 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus sp. JNUCC-21 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2631618..2641791
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JNUCC21_RS13065 (JNUCC21_13095) | gcvT | 2632431..2633531 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| JNUCC21_RS13070 (JNUCC21_13100) | - | 2633955..2635625 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| JNUCC21_RS13075 (JNUCC21_13105) | - | 2635647..2636441 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| JNUCC21_RS13080 (JNUCC21_13110) | sinI | 2636618..2636791 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| JNUCC21_RS13085 (JNUCC21_13115) | sinR | 2636825..2637160 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| JNUCC21_RS13090 (JNUCC21_13120) | tasA | 2637208..2637993 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| JNUCC21_RS13095 (JNUCC21_13125) | sipW | 2638058..2638642 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| JNUCC21_RS13100 (JNUCC21_13130) | tapA | 2638614..2639285 (-) | 672 | WP_150941310.1 | amyloid fiber anchoring/assembly protein TapA | - |
| JNUCC21_RS13105 (JNUCC21_13135) | - | 2639544..2639873 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| JNUCC21_RS13110 (JNUCC21_13140) | - | 2639914..2640093 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| JNUCC21_RS13115 (JNUCC21_13145) | comGG | 2640150..2640527 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| JNUCC21_RS13120 (JNUCC21_13150) | comGF | 2640528..2641028 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| JNUCC21_RS13125 (JNUCC21_13155) | comGE | 2640937..2641251 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| JNUCC21_RS13130 (JNUCC21_13160) | comGD | 2641235..2641672 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1033123 JNUCC21_RS13080 WP_003153105.1 2636618..2636791(+) (sinI) [Bacillus sp. JNUCC-21]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1033123 JNUCC21_RS13080 WP_003153105.1 2636618..2636791(+) (sinI) [Bacillus sp. JNUCC-21]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |