Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AB7T04_RS01990 Genome accession   NZ_CP165780
Coordinates   389812..389931 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain L-15     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 384812..394931
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB7T04_RS01975 (AB7T04_01975) - 386424..387107 (+) 684 WP_014416901.1 response regulator transcription factor -
  AB7T04_RS01980 (AB7T04_01980) - 387094..388527 (+) 1434 WP_187297950.1 HAMP domain-containing sensor histidine kinase -
  AB7T04_RS01985 (AB7T04_01985) rapC 388680..389828 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  AB7T04_RS01990 (AB7T04_01990) phrC 389812..389931 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB7T04_RS01995 (AB7T04_01995) - 390081..390191 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  AB7T04_RS02000 (AB7T04_02000) - 390271..391635 (-) 1365 WP_071392130.1 aspartate kinase -
  AB7T04_RS02005 (AB7T04_02005) ceuB 392050..393003 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  AB7T04_RS02010 (AB7T04_02010) - 392993..393940 (+) 948 WP_264101332.1 iron chelate uptake ABC transporter family permease subunit -
  AB7T04_RS02015 (AB7T04_02015) - 393934..394692 (+) 759 WP_264101333.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1031702 AB7T04_RS01990 WP_003156334.1 389812..389931(+) (phrC) [Bacillus velezensis strain L-15]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1031702 AB7T04_RS01990 WP_003156334.1 389812..389931(+) (phrC) [Bacillus velezensis strain L-15]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment