Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB3D65_RS04395 | Genome accession | NZ_CP165606 |
| Coordinates | 775928..776101 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain BP1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 770928..781101
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB3D65_RS04345 (AB3D65_04345) | comGD | 771047..771484 (+) | 438 | WP_369546435.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AB3D65_RS04350 (AB3D65_04350) | comGE | 771468..771782 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| AB3D65_RS04355 (AB3D65_04355) | comGF | 771691..772191 (+) | 501 | WP_369546436.1 | competence type IV pilus minor pilin ComGF | - |
| AB3D65_RS04360 (AB3D65_04360) | comGG | 772192..772569 (+) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB3D65_RS04365 (AB3D65_04365) | - | 772626..772805 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB3D65_RS04370 (AB3D65_04370) | - | 772845..773174 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB3D65_RS04375 (AB3D65_04375) | tapA | 773433..774104 (+) | 672 | WP_151296368.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB3D65_RS04380 (AB3D65_04380) | sipW | 774076..774660 (+) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| AB3D65_RS04385 (AB3D65_04385) | tasA | 774726..775511 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB3D65_RS04390 (AB3D65_04390) | sinR | 775559..775894 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB3D65_RS04395 (AB3D65_04395) | sinI | 775928..776101 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB3D65_RS04400 (AB3D65_04400) | - | 776278..777072 (-) | 795 | WP_369546439.1 | YqhG family protein | - |
| AB3D65_RS04405 (AB3D65_04405) | - | 777094..778764 (-) | 1671 | WP_132105375.1 | DEAD/DEAH box helicase | - |
| AB3D65_RS04410 (AB3D65_04410) | gcvT | 779188..780288 (+) | 1101 | WP_283886845.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1030790 AB3D65_RS04395 WP_003153105.1 775928..776101(-) (sinI) [Bacillus velezensis strain BP1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1030790 AB3D65_RS04395 WP_003153105.1 775928..776101(-) (sinI) [Bacillus velezensis strain BP1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |