Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AB3D65_RS04360 Genome accession   NZ_CP165606
Coordinates   772192..772569 (+) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain BP1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 767192..777569
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3D65_RS04325 (AB3D65_04325) - 767507..768457 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  AB3D65_RS04330 (AB3D65_04330) comGA 768650..769720 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  AB3D65_RS04335 (AB3D65_04335) comGB 769707..770744 (+) 1038 WP_369546434.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB3D65_RS04340 (AB3D65_04340) comGC 770749..771057 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB3D65_RS04345 (AB3D65_04345) comGD 771047..771484 (+) 438 WP_369546435.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB3D65_RS04350 (AB3D65_04350) comGE 771468..771782 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  AB3D65_RS04355 (AB3D65_04355) comGF 771691..772191 (+) 501 WP_369546436.1 competence type IV pilus minor pilin ComGF -
  AB3D65_RS04360 (AB3D65_04360) comGG 772192..772569 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB3D65_RS04365 (AB3D65_04365) - 772626..772805 (+) 180 WP_003153093.1 YqzE family protein -
  AB3D65_RS04370 (AB3D65_04370) - 772845..773174 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  AB3D65_RS04375 (AB3D65_04375) tapA 773433..774104 (+) 672 WP_151296368.1 amyloid fiber anchoring/assembly protein TapA -
  AB3D65_RS04380 (AB3D65_04380) sipW 774076..774660 (+) 585 WP_012117977.1 signal peptidase I SipW -
  AB3D65_RS04385 (AB3D65_04385) tasA 774726..775511 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB3D65_RS04390 (AB3D65_04390) sinR 775559..775894 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB3D65_RS04395 (AB3D65_04395) sinI 775928..776101 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB3D65_RS04400 (AB3D65_04400) - 776278..777072 (-) 795 WP_369546439.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=1030788 AB3D65_RS04360 WP_015417814.1 772192..772569(+) (comGG) [Bacillus velezensis strain BP1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1030788 AB3D65_RS04360 WP_015417814.1 772192..772569(+) (comGG) [Bacillus velezensis strain BP1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment