Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB4K06_RS14790 Genome accession   NZ_CP163458
Coordinates   2821078..2821251 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain N33     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2816078..2826251
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB4K06_RS14775 (AB4K06_14775) gcvT 2816877..2817965 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  AB4K06_RS14780 (AB4K06_14780) hepAA 2818407..2820080 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  AB4K06_RS14785 (AB4K06_14785) yqhG 2820101..2820895 (+) 795 WP_003230200.1 YqhG family protein -
  AB4K06_RS14790 (AB4K06_14790) sinI 2821078..2821251 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB4K06_RS14795 (AB4K06_14795) sinR 2821285..2821620 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB4K06_RS14800 (AB4K06_14800) tasA 2821713..2822498 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  AB4K06_RS14805 (AB4K06_14805) sipW 2822562..2823134 (-) 573 WP_003246088.1 signal peptidase I SipW -
  AB4K06_RS14810 (AB4K06_14810) tapA 2823118..2823879 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  AB4K06_RS14815 (AB4K06_14815) yqzG 2824151..2824477 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB4K06_RS14820 (AB4K06_14820) spoIITA 2824519..2824698 (-) 180 WP_003230176.1 YqzE family protein -
  AB4K06_RS14825 (AB4K06_14825) comGG 2824769..2825143 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  AB4K06_RS14830 (AB4K06_14830) comGF 2825144..2825527 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  AB4K06_RS14835 (AB4K06_14835) comGE 2825553..2825900 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1029997 AB4K06_RS14790 WP_003230187.1 2821078..2821251(+) (sinI) [Bacillus subtilis strain N33]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1029997 AB4K06_RS14790 WP_003230187.1 2821078..2821251(+) (sinI) [Bacillus subtilis strain N33]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment