Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AB4K06_RS14830 Genome accession   NZ_CP163458
Coordinates   2825144..2825527 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain N33     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2820144..2830527
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB4K06_RS14790 (AB4K06_14790) sinI 2821078..2821251 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB4K06_RS14795 (AB4K06_14795) sinR 2821285..2821620 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB4K06_RS14800 (AB4K06_14800) tasA 2821713..2822498 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  AB4K06_RS14805 (AB4K06_14805) sipW 2822562..2823134 (-) 573 WP_003246088.1 signal peptidase I SipW -
  AB4K06_RS14810 (AB4K06_14810) tapA 2823118..2823879 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  AB4K06_RS14815 (AB4K06_14815) yqzG 2824151..2824477 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB4K06_RS14820 (AB4K06_14820) spoIITA 2824519..2824698 (-) 180 WP_003230176.1 YqzE family protein -
  AB4K06_RS14825 (AB4K06_14825) comGG 2824769..2825143 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  AB4K06_RS14830 (AB4K06_14830) comGF 2825144..2825527 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  AB4K06_RS14835 (AB4K06_14835) comGE 2825553..2825900 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AB4K06_RS14840 (AB4K06_14840) comGD 2825884..2826315 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  AB4K06_RS14845 (AB4K06_14845) comGC 2826305..2826601 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AB4K06_RS14850 (AB4K06_14850) comGB 2826615..2827652 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  AB4K06_RS14855 (AB4K06_14855) comGA 2827639..2828709 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AB4K06_RS14860 (AB4K06_14860) corA 2829121..2830074 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=1030000 AB4K06_RS14830 WP_003230168.1 2825144..2825527(-) (comGF) [Bacillus subtilis strain N33]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1030000 AB4K06_RS14830 WP_003230168.1 2825144..2825527(-) (comGF) [Bacillus subtilis strain N33]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment