Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB3G27_RS14565 Genome accession   NZ_CP162095
Coordinates   2851219..2851359 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain LBUM494     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2846219..2856359
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3G27_RS14540 (AB3G27_14540) - 2846541..2846930 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  AB3G27_RS14545 (AB3G27_14545) comA 2846954..2847595 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  AB3G27_RS14550 (AB3G27_14550) comP 2847676..2849982 (-) 2307 WP_044140820.1 ATP-binding protein Regulator
  AB3G27_RS14555 (AB3G27_14555) comX 2849996..2850166 (-) 171 WP_012011107.1 competence pheromone ComX -
  AB3G27_RS14560 (AB3G27_14560) - 2850144..2851067 (-) 924 WP_106029260.1 polyprenyl synthetase family protein -
  AB3G27_RS14565 (AB3G27_14565) degQ 2851219..2851359 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AB3G27_RS14570 (AB3G27_14570) - 2851865..2852218 (+) 354 WP_212045491.1 inner spore coat protein -
  AB3G27_RS14575 (AB3G27_14575) - 2852249..2853475 (-) 1227 WP_212045764.1 EAL and HDOD domain-containing protein -
  AB3G27_RS14580 (AB3G27_14580) - 2853616..2855085 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  AB3G27_RS14585 (AB3G27_14585) - 2855103..2855654 (-) 552 WP_003213138.1 cysteine hydrolase family protein -
  AB3G27_RS14590 (AB3G27_14590) - 2855715..2856122 (-) 408 WP_050944045.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1024006 AB3G27_RS14565 WP_003213123.1 2851219..2851359(-) (degQ) [Bacillus pumilus strain LBUM494]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1024006 AB3G27_RS14565 WP_003213123.1 2851219..2851359(-) (degQ) [Bacillus pumilus strain LBUM494]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment