Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AB2M34_RS05450 Genome accession   NZ_CP161903
Coordinates   1033970..1034110 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DYJ24     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1028970..1039110
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB2M34_RS05420 (AB2M34_05420) yueI 1029265..1029663 (+) 399 WP_014480710.1 YueI family protein -
  AB2M34_RS05425 (AB2M34_05425) pncA 1029760..1030311 (+) 552 WP_014480709.1 cysteine hydrolase family protein -
  AB2M34_RS05430 (AB2M34_05430) pncB 1030327..1031799 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AB2M34_RS05435 (AB2M34_05435) pdeH 1031935..1033164 (+) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  AB2M34_RS05440 (AB2M34_05440) - 1033140..1033508 (-) 369 WP_050258610.1 hypothetical protein -
  AB2M34_RS05445 (AB2M34_05445) - 1033623..1033748 (-) 126 WP_003228793.1 hypothetical protein -
  AB2M34_RS05450 (AB2M34_05450) degQ 1033970..1034110 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AB2M34_RS05455 (AB2M34_05455) - 1034295..1035158 (+) 864 WP_014480705.1 polyprenyl synthetase family protein -
  AB2M34_RS05460 (AB2M34_05460) comX 1035160..1035381 (+) 222 WP_014480704.1 competence pheromone ComX -
  AB2M34_RS05465 (AB2M34_05465) comP 1035397..1037709 (+) 2313 WP_103330147.1 sensor histidine kinase Regulator
  AB2M34_RS05470 (AB2M34_05470) comA 1037790..1038434 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AB2M34_RS05475 (AB2M34_05475) yuxO 1038453..1038833 (+) 381 WP_069837723.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1023048 AB2M34_RS05450 WP_003220708.1 1033970..1034110(+) (degQ) [Bacillus subtilis strain DYJ24]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1023048 AB2M34_RS05450 WP_003220708.1 1033970..1034110(+) (degQ) [Bacillus subtilis strain DYJ24]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment