Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AB2M35_RS13185 Genome accession   NZ_CP161902
Coordinates   2470216..2470590 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain DYJ22     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2465216..2475590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB2M35_RS13145 (AB2M35_13145) yqhG 2465548..2466342 (+) 795 WP_014480249.1 YqhG family protein -
  AB2M35_RS13150 (AB2M35_13150) sinI 2466525..2466698 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB2M35_RS13155 (AB2M35_13155) sinR 2466732..2467067 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB2M35_RS13160 (AB2M35_13160) tasA 2467160..2467945 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  AB2M35_RS13165 (AB2M35_13165) sipW 2468009..2468581 (-) 573 WP_003230181.1 signal peptidase I SipW -
  AB2M35_RS13170 (AB2M35_13170) tapA 2468565..2469326 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  AB2M35_RS13175 (AB2M35_13175) yqzG 2469598..2469924 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB2M35_RS13180 (AB2M35_13180) spoIITA 2469966..2470145 (-) 180 WP_014480252.1 YqzE family protein -
  AB2M35_RS13185 (AB2M35_13185) comGG 2470216..2470590 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AB2M35_RS13190 (AB2M35_13190) comGF 2470591..2470974 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  AB2M35_RS13195 (AB2M35_13195) comGE 2471000..2471347 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  AB2M35_RS13200 (AB2M35_13200) comGD 2471331..2471762 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  AB2M35_RS13205 (AB2M35_13205) comGC 2471752..2472048 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AB2M35_RS13210 (AB2M35_13210) comGB 2472062..2473099 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  AB2M35_RS13215 (AB2M35_13215) comGA 2473086..2474156 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AB2M35_RS13220 (AB2M35_13220) - 2474368..2474565 (-) 198 WP_014480259.1 CBS domain-containing protein -
  AB2M35_RS13225 (AB2M35_13225) corA 2474567..2475520 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=1022995 AB2M35_RS13185 WP_014480253.1 2470216..2470590(-) (comGG) [Bacillus subtilis strain DYJ22]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1022995 AB2M35_RS13185 WP_014480253.1 2470216..2470590(-) (comGG) [Bacillus subtilis strain DYJ22]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment