Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB2M35_RS13150 Genome accession   NZ_CP161902
Coordinates   2466525..2466698 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain DYJ22     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2461525..2471698
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB2M35_RS13135 (AB2M35_13135) gcvT 2462325..2463413 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  AB2M35_RS13140 (AB2M35_13140) hepAA 2463854..2465527 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  AB2M35_RS13145 (AB2M35_13145) yqhG 2465548..2466342 (+) 795 WP_014480249.1 YqhG family protein -
  AB2M35_RS13150 (AB2M35_13150) sinI 2466525..2466698 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB2M35_RS13155 (AB2M35_13155) sinR 2466732..2467067 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB2M35_RS13160 (AB2M35_13160) tasA 2467160..2467945 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  AB2M35_RS13165 (AB2M35_13165) sipW 2468009..2468581 (-) 573 WP_003230181.1 signal peptidase I SipW -
  AB2M35_RS13170 (AB2M35_13170) tapA 2468565..2469326 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  AB2M35_RS13175 (AB2M35_13175) yqzG 2469598..2469924 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB2M35_RS13180 (AB2M35_13180) spoIITA 2469966..2470145 (-) 180 WP_014480252.1 YqzE family protein -
  AB2M35_RS13185 (AB2M35_13185) comGG 2470216..2470590 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AB2M35_RS13190 (AB2M35_13190) comGF 2470591..2470974 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  AB2M35_RS13195 (AB2M35_13195) comGE 2471000..2471347 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1022993 AB2M35_RS13150 WP_003230187.1 2466525..2466698(+) (sinI) [Bacillus subtilis strain DYJ22]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1022993 AB2M35_RS13150 WP_003230187.1 2466525..2466698(+) (sinI) [Bacillus subtilis strain DYJ22]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment