Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | AB1O90_RS04080 | Genome accession | NZ_CP161340 |
| Coordinates | 829606..830049 (+) | Length | 147 a.a. |
| NCBI ID | WP_367599980.1 | Uniprot ID | - |
| Organism | Pediococcus pentosaceus strain RS-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 818324..856823 | 829606..830049 | within | 0 |
Gene organization within MGE regions
Location: 818324..856823
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB1O90_RS03980 (AB1O90_03980) | - | 818324..819496 (-) | 1173 | WP_367599972.1 | tyrosine-type recombinase/integrase | - |
| AB1O90_RS03985 (AB1O90_03985) | - | 819593..819895 (-) | 303 | WP_029257881.1 | hypothetical protein | - |
| AB1O90_RS03990 (AB1O90_03990) | - | 820033..820227 (+) | 195 | WP_367599973.1 | hypothetical protein | - |
| AB1O90_RS03995 (AB1O90_03995) | - | 820229..820810 (-) | 582 | WP_367599974.1 | TIR domain-containing protein | - |
| AB1O90_RS04000 (AB1O90_04000) | - | 820797..821279 (-) | 483 | WP_367599975.1 | DUF4231 domain-containing protein | - |
| AB1O90_RS04005 (AB1O90_04005) | - | 821389..822594 (-) | 1206 | WP_367599976.1 | DUF5067 domain-containing protein | - |
| AB1O90_RS04010 (AB1O90_04010) | - | 822654..823052 (-) | 399 | WP_263795093.1 | hypothetical protein | - |
| AB1O90_RS04015 (AB1O90_04015) | - | 823056..823430 (-) | 375 | WP_081332163.1 | helix-turn-helix domain-containing protein | - |
| AB1O90_RS04020 (AB1O90_04020) | - | 823595..823828 (+) | 234 | WP_069825265.1 | XRE family transcriptional regulator | - |
| AB1O90_RS04025 (AB1O90_04025) | - | 823825..823986 (+) | 162 | WP_263795094.1 | hypothetical protein | - |
| AB1O90_RS04030 (AB1O90_04030) | - | 823967..824788 (-) | 822 | WP_263795095.1 | TIGR02391 family protein | - |
| AB1O90_RS04035 (AB1O90_04035) | - | 824861..825031 (+) | 171 | WP_233671688.1 | hypothetical protein | - |
| AB1O90_RS04040 (AB1O90_04040) | - | 825105..825563 (+) | 459 | WP_233605434.1 | helix-turn-helix domain-containing protein | - |
| AB1O90_RS04045 (AB1O90_04045) | - | 825564..825839 (+) | 276 | WP_263795097.1 | helix-turn-helix domain-containing protein | - |
| AB1O90_RS04050 (AB1O90_04050) | - | 825853..825984 (+) | 132 | WP_256677761.1 | hypothetical protein | - |
| AB1O90_RS04055 (AB1O90_04055) | bet | 826180..826944 (+) | 765 | WP_367599977.1 | phage recombination protein Bet | - |
| AB1O90_RS04060 (AB1O90_04060) | - | 826904..827749 (+) | 846 | WP_367599978.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| AB1O90_RS04065 (AB1O90_04065) | - | 827760..828485 (+) | 726 | WP_367599979.1 | helix-turn-helix domain-containing protein | - |
| AB1O90_RS04070 (AB1O90_04070) | - | 828635..829327 (+) | 693 | WP_263795101.1 | putative HNHc nuclease | - |
| AB1O90_RS04075 (AB1O90_04075) | - | 829305..829613 (+) | 309 | WP_159234097.1 | hypothetical protein | - |
| AB1O90_RS04080 (AB1O90_04080) | ssb | 829606..830049 (+) | 444 | WP_367599980.1 | single-stranded DNA-binding protein | Machinery gene |
| AB1O90_RS04085 (AB1O90_04085) | - | 830217..830381 (-) | 165 | WP_199876727.1 | YjzC family protein | - |
| AB1O90_RS04090 (AB1O90_04090) | - | 830521..830712 (+) | 192 | WP_195753221.1 | helix-turn-helix transcriptional regulator | - |
| AB1O90_RS04095 (AB1O90_04095) | - | 830715..831020 (+) | 306 | WP_367599981.1 | DeoR family transcriptional regulator | - |
| AB1O90_RS04100 (AB1O90_04100) | - | 831031..831216 (+) | 186 | WP_367599982.1 | hypothetical protein | - |
| AB1O90_RS04105 (AB1O90_04105) | - | 831228..831452 (+) | 225 | WP_159276385.1 | hypothetical protein | - |
| AB1O90_RS04110 (AB1O90_04110) | - | 831463..831585 (+) | 123 | WP_367599983.1 | hypothetical protein | - |
| AB1O90_RS04115 (AB1O90_04115) | - | 831671..832102 (+) | 432 | WP_367599984.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AB1O90_RS04120 (AB1O90_04120) | - | 832283..832723 (+) | 441 | WP_367599985.1 | hypothetical protein | - |
| AB1O90_RS04125 (AB1O90_04125) | - | 832900..833520 (+) | 621 | WP_367599986.1 | hypothetical protein | - |
| AB1O90_RS04130 (AB1O90_04130) | - | 833605..833946 (+) | 342 | WP_195751017.1 | phBC6A51 family helix-turn-helix protein | - |
| AB1O90_RS04135 (AB1O90_04135) | - | 833939..835210 (+) | 1272 | WP_195751173.1 | PBSX family phage terminase large subunit | - |
| AB1O90_RS04140 (AB1O90_04140) | - | 835267..836811 (+) | 1545 | WP_367599987.1 | phage portal protein | - |
| AB1O90_RS04145 (AB1O90_04145) | - | 836795..837739 (+) | 945 | WP_367599988.1 | minor capsid protein | - |
| AB1O90_RS04150 (AB1O90_04150) | - | 838056..838631 (+) | 576 | WP_195751022.1 | DUF4355 domain-containing protein | - |
| AB1O90_RS04155 (AB1O90_04155) | - | 838644..839501 (+) | 858 | WP_259765511.1 | capsid protein | - |
| AB1O90_RS04160 (AB1O90_04160) | - | 839519..839785 (+) | 267 | WP_195751174.1 | Ig-like domain-containing protein | - |
| AB1O90_RS04165 (AB1O90_04165) | - | 839799..840137 (+) | 339 | WP_260295192.1 | phage head-tail connector protein | - |
| AB1O90_RS04170 (AB1O90_04170) | - | 840137..840427 (+) | 291 | WP_367599989.1 | hypothetical protein | - |
| AB1O90_RS04175 (AB1O90_04175) | - | 840424..840780 (+) | 357 | WP_195751026.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AB1O90_RS04180 (AB1O90_04180) | - | 840773..841141 (+) | 369 | WP_195751027.1 | hypothetical protein | - |
| AB1O90_RS04185 (AB1O90_04185) | - | 841159..841755 (+) | 597 | WP_195751028.1 | phage major tail protein, TP901-1 family | - |
| AB1O90_RS04190 (AB1O90_04190) | - | 841745..842005 (+) | 261 | WP_195751029.1 | Ig-like domain-containing protein | - |
| AB1O90_RS04195 (AB1O90_04195) | - | 842084..842533 (+) | 450 | WP_195751030.1 | tail assembly chaperone | - |
| AB1O90_RS04200 (AB1O90_04200) | - | 842623..842841 (+) | 219 | WP_195751031.1 | hypothetical protein | - |
| AB1O90_RS04205 (AB1O90_04205) | - | 842841..846662 (+) | 3822 | WP_367599990.1 | phage tail tape measure protein | - |
| AB1O90_RS04210 (AB1O90_04210) | - | 846677..847507 (+) | 831 | WP_259765521.1 | phage tail protein | - |
| AB1O90_RS04215 (AB1O90_04215) | - | 847526..851662 (+) | 4137 | WP_367599991.1 | phage tail protein | - |
| AB1O90_RS04220 (AB1O90_04220) | - | 851659..851898 (+) | 240 | WP_259765526.1 | hypothetical protein | - |
| AB1O90_RS04225 (AB1O90_04225) | - | 851888..852313 (+) | 426 | WP_367599992.1 | hypothetical protein | - |
| AB1O90_RS04230 (AB1O90_04230) | - | 852315..852566 (+) | 252 | WP_367599993.1 | hypothetical protein | - |
| AB1O90_RS04235 (AB1O90_04235) | - | 852600..853118 (+) | 519 | WP_195751037.1 | phage holin family protein | - |
| AB1O90_RS04240 (AB1O90_04240) | - | 853102..854319 (+) | 1218 | WP_367599994.1 | GH25 family lysozyme | - |
| AB1O90_RS04245 (AB1O90_04245) | - | 855447..856823 (+) | 1377 | WP_002833594.1 | amino acid permease | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16612.35 Da Isoelectric Point: 7.8230
>NTDB_id=1022366 AB1O90_RS04080 WP_367599980.1 829606..830049(+) (ssb) [Pediococcus pentosaceus strain RS-1]
MINRTVLVGRLTNDPKLKYTGSGLAVATFTVAVNRQFTNSQGEHEADFIRCQMWRKAAENFCNFTRKGSLVGIDGRIQTR
SYENQQGTRIFVTEVVAENFSLLESKNSNQNNGQNYQNQQNGQSSPSRNPNDPFNSMPEIKDDDLPF
MINRTVLVGRLTNDPKLKYTGSGLAVATFTVAVNRQFTNSQGEHEADFIRCQMWRKAAENFCNFTRKGSLVGIDGRIQTR
SYENQQGTRIFVTEVVAENFSLLESKNSNQNNGQNYQNQQNGQSSPSRNPNDPFNSMPEIKDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=1022366 AB1O90_RS04080 WP_367599980.1 829606..830049(+) (ssb) [Pediococcus pentosaceus strain RS-1]
ATGATTAATCGAACAGTATTAGTCGGACGGTTAACTAACGATCCAAAACTAAAATACACAGGAAGTGGTTTGGCAGTTGC
AACTTTTACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAACATGAAGCAGATTTTATTAGATGCCAAATGT
GGCGCAAAGCAGCTGAAAATTTTTGTAACTTCACTCGAAAAGGTTCACTAGTTGGCATTGACGGACGGATTCAAACCCGT
TCTTATGAAAACCAACAAGGAACACGAATTTTTGTTACTGAGGTCGTAGCTGAGAACTTCTCGTTGCTTGAATCTAAAAA
CAGCAATCAAAATAACGGACAAAACTACCAGAATCAACAAAATGGTCAATCATCACCTAGCAGAAATCCTAACGACCCAT
TTAATAGCATGCCGGAGATCAAGGATGACGATTTACCGTTCTAG
ATGATTAATCGAACAGTATTAGTCGGACGGTTAACTAACGATCCAAAACTAAAATACACAGGAAGTGGTTTGGCAGTTGC
AACTTTTACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAACATGAAGCAGATTTTATTAGATGCCAAATGT
GGCGCAAAGCAGCTGAAAATTTTTGTAACTTCACTCGAAAAGGTTCACTAGTTGGCATTGACGGACGGATTCAAACCCGT
TCTTATGAAAACCAACAAGGAACACGAATTTTTGTTACTGAGGTCGTAGCTGAGAACTTCTCGTTGCTTGAATCTAAAAA
CAGCAATCAAAATAACGGACAAAACTACCAGAATCAACAAAATGGTCAATCATCACCTAGCAGAAATCCTAACGACCCAT
TTAATAGCATGCCGGAGATCAAGGATGACGATTTACCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.897 |
100 |
0.673 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.445 |
100 |
0.605 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.66 |
72.109 |
0.401 |