Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABZM97_RS16400 Genome accession   NZ_CP160797
Coordinates   3278358..3278498 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus vallismortis strain BL-01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3273358..3283498
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABZM97_RS16375 (ABZM97_16375) - 3273634..3274014 (-) 381 WP_253268529.1 hotdog fold thioesterase -
  ABZM97_RS16380 (ABZM97_16380) comA 3274033..3274677 (-) 645 WP_202328144.1 two-component system response regulator ComA Regulator
  ABZM97_RS16385 (ABZM97_16385) comP 3274758..3277070 (-) 2313 WP_367386987.1 histidine kinase Regulator
  ABZM97_RS16390 (ABZM97_16390) comX 3277086..3277307 (-) 222 WP_367386988.1 competence pheromone ComX -
  ABZM97_RS16395 (ABZM97_16395) - 3277304..3278173 (-) 870 WP_367386989.1 polyprenyl synthetase family protein -
  ABZM97_RS16400 (ABZM97_16400) degQ 3278358..3278498 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABZM97_RS16405 (ABZM97_16405) - 3278788..3278925 (-) 138 WP_176365307.1 hypothetical protein -
  ABZM97_RS16410 (ABZM97_16410) - 3278958..3279323 (+) 366 WP_087993278.1 hypothetical protein -
  ABZM97_RS16415 (ABZM97_16415) pdeH 3279302..3280531 (-) 1230 WP_087993279.1 cyclic di-GMP phosphodiesterase -
  ABZM97_RS16420 (ABZM97_16420) - 3280674..3282140 (-) 1467 WP_333516464.1 nicotinate phosphoribosyltransferase -
  ABZM97_RS16425 (ABZM97_16425) - 3282156..3282707 (-) 552 WP_087993281.1 cysteine hydrolase family protein -
  ABZM97_RS16430 (ABZM97_16430) - 3282804..3283202 (-) 399 WP_087993282.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1022055 ABZM97_RS16400 WP_003220708.1 3278358..3278498(-) (degQ) [Bacillus vallismortis strain BL-01]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1022055 ABZM97_RS16400 WP_003220708.1 3278358..3278498(-) (degQ) [Bacillus vallismortis strain BL-01]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment