Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ABZM97_RS12645 Genome accession   NZ_CP160797
Coordinates   2594668..2595075 (-) Length   135 a.a.
NCBI ID   WP_284690388.1    Uniprot ID   -
Organism   Bacillus vallismortis strain BL-01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2589668..2600075
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABZM97_RS12605 (ABZM97_12605) sinI 2590611..2590784 (+) 174 WP_087990694.1 anti-repressor SinI Regulator
  ABZM97_RS12610 (ABZM97_12610) sinR 2590818..2591153 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABZM97_RS12615 (ABZM97_12615) tasA 2591245..2592030 (-) 786 WP_087990695.1 biofilm matrix protein TasA -
  ABZM97_RS12620 (ABZM97_12620) sipW 2592093..2592665 (-) 573 WP_087990816.1 signal peptidase I SipW -
  ABZM97_RS12625 (ABZM97_12625) tapA 2592649..2593410 (-) 762 WP_202327199.1 amyloid fiber anchoring/assembly protein TapA -
  ABZM97_RS12630 (ABZM97_12630) - 2593672..2594001 (+) 330 WP_087990817.1 YqzG/YhdC family protein -
  ABZM97_RS12635 (ABZM97_12635) - 2594045..2594224 (-) 180 WP_087990697.1 YqzE family protein -
  ABZM97_RS12640 (ABZM97_12640) comGG 2594293..2594667 (-) 375 WP_367386868.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABZM97_RS12645 (ABZM97_12645) comGF 2594668..2595075 (-) 408 WP_284690388.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABZM97_RS12650 (ABZM97_12650) comGE 2595077..2595424 (-) 348 WP_087990700.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABZM97_RS12655 (ABZM97_12655) comGD 2595408..2595839 (-) 432 WP_087990701.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABZM97_RS12660 (ABZM97_12660) comGC 2595829..2596125 (-) 297 WP_087990702.1 comG operon protein ComGC Machinery gene
  ABZM97_RS12665 (ABZM97_12665) comGB 2596139..2597176 (-) 1038 WP_202327196.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABZM97_RS12670 (ABZM97_12670) comGA 2597163..2598233 (-) 1071 WP_367386869.1 competence protein ComGA Machinery gene
  ABZM97_RS12675 (ABZM97_12675) - 2598449..2598859 (-) 411 WP_087990705.1 CBS domain-containing protein -
  ABZM97_RS12680 (ABZM97_12680) - 2598922..2599875 (-) 954 WP_087990706.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 135 a.a.        Molecular weight: 15410.86 Da        Isoelectric Point: 6.9672

>NTDB_id=1022034 ABZM97_RS12645 WP_284690388.1 2594668..2595075(-) (comGF) [Bacillus vallismortis strain BL-01]
MLFSLSVFLLISGSLAMIFHLFLSRQQGYDGFTEQEWMISVEQMMNECKQSRAVKTTEHGSVLICTNLSGQDIRFETYHS
MIRKRVDGKGHVPILDHITVMKADIENGMVLLKIESENQKVYQTAFPVYRYLGGG

Nucleotide


Download         Length: 408 bp        

>NTDB_id=1022034 ABZM97_RS12645 WP_284690388.1 2594668..2595075(-) (comGF) [Bacillus vallismortis strain BL-01]
ATATTATTTTCGCTTTCTGTCTTTTTACTCATATCAGGATCGTTAGCTATGATCTTCCATCTGTTTTTGTCGCGCCAACA
GGGATATGACGGTTTCACAGAGCAAGAATGGATGATTTCGGTGGAGCAGATGATGAACGAGTGCAAGCAGTCCCGCGCAG
TCAAAACAACTGAGCATGGGAGCGTATTGATTTGCACCAATCTTTCCGGGCAAGACATCCGTTTTGAAACCTATCATTCA
ATGATAAGAAAAAGGGTAGATGGGAAAGGGCATGTTCCGATACTAGATCATATTACAGTCATGAAAGCCGATATTGAAAA
TGGAATGGTTTTGTTAAAAATTGAGAGTGAGAATCAAAAAGTGTATCAAACTGCTTTTCCGGTTTATCGGTATTTAGGAG
GAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

87.402

94.074

0.822


Multiple sequence alignment