Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ABZM97_RS12605 Genome accession   NZ_CP160797
Coordinates   2590611..2590784 (+) Length   57 a.a.
NCBI ID   WP_087990694.1    Uniprot ID   -
Organism   Bacillus vallismortis strain BL-01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2585611..2595784
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABZM97_RS12590 (ABZM97_12590) gcvT 2586408..2587496 (-) 1089 WP_087990691.1 glycine cleavage system aminomethyltransferase GcvT -
  ABZM97_RS12595 (ABZM97_12595) - 2587939..2589612 (+) 1674 WP_367386867.1 DEAD/DEAH box helicase -
  ABZM97_RS12600 (ABZM97_12600) - 2589633..2590427 (+) 795 WP_253268418.1 YqhG family protein -
  ABZM97_RS12605 (ABZM97_12605) sinI 2590611..2590784 (+) 174 WP_087990694.1 anti-repressor SinI Regulator
  ABZM97_RS12610 (ABZM97_12610) sinR 2590818..2591153 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABZM97_RS12615 (ABZM97_12615) tasA 2591245..2592030 (-) 786 WP_087990695.1 biofilm matrix protein TasA -
  ABZM97_RS12620 (ABZM97_12620) sipW 2592093..2592665 (-) 573 WP_087990816.1 signal peptidase I SipW -
  ABZM97_RS12625 (ABZM97_12625) tapA 2592649..2593410 (-) 762 WP_202327199.1 amyloid fiber anchoring/assembly protein TapA -
  ABZM97_RS12630 (ABZM97_12630) - 2593672..2594001 (+) 330 WP_087990817.1 YqzG/YhdC family protein -
  ABZM97_RS12635 (ABZM97_12635) - 2594045..2594224 (-) 180 WP_087990697.1 YqzE family protein -
  ABZM97_RS12640 (ABZM97_12640) comGG 2594293..2594667 (-) 375 WP_367386868.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABZM97_RS12645 (ABZM97_12645) comGF 2594668..2595075 (-) 408 WP_284690388.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABZM97_RS12650 (ABZM97_12650) comGE 2595077..2595424 (-) 348 WP_087990700.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6631.70 Da        Isoelectric Point: 10.1505

>NTDB_id=1022031 ABZM97_RS12605 WP_087990694.1 2590611..2590784(+) (sinI) [Bacillus vallismortis strain BL-01]
MKNAKQEHFELDQEWVKLMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1022031 ABZM97_RS12605 WP_087990694.1 2590611..2590784(+) (sinI) [Bacillus vallismortis strain BL-01]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTAAATTGATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

94.737

100

0.947

Multiple sequence alignment