Detailed information NTG1020202

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R72_RS13480
• Genome accession: NZ_CP160229
• Coordinates: 2754353..2754790 (-)
• Length: 145 a.a.
• NCBI ID: WP_094032243.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain AP46
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2749353..2759790

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R72_RS13430 (AB0R72_13435)	sinI	2749737..2749910 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB0R72_RS13435 (AB0R72_13440)	sinR	2749944..2750279 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R72_RS13440 (AB0R72_13445)	tasA	2750327..2751112 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB0R72_RS13445 (AB0R72_13450)	sipW	2751177..2751761 (-)	585	WP_015240205.1	signal peptidase I SipW	-
AB0R72_RS13450 (AB0R72_13455)	tapA	2751733..2752404 (-)	672	WP_015417813.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R72_RS13455 (AB0R72_13460)	-	2752663..2752992 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
AB0R72_RS13460 (AB0R72_13465)	-	2753032..2753211 (-)	180	WP_003153093.1	YqzE family protein	-
AB0R72_RS13465 (AB0R72_13470)	comGG	2753268..2753645 (-)	378	WP_015417814.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R72_RS13470 (AB0R72_13475)	comGF	2753646..2754146 (-)	501	WP_254922226.1	competence type IV pilus minor pilin ComGF	-
AB0R72_RS13475 (AB0R72_13480)	comGE	2754055..2754369 (-)	315	WP_094032244.1	competence type IV pilus minor pilin ComGE	-
AB0R72_RS13480 (AB0R72_13485)	comGD	2754353..2754790 (-)	438	WP_094032243.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R72_RS13485 (AB0R72_13490)	comGC	2754780..2755088 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R72_RS13490 (AB0R72_13495)	comGB	2755093..2756130 (-)	1038	WP_015417819.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R72_RS13495 (AB0R72_13500)	comGA	2756117..2757187 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R72_RS13500 (AB0R72_13505)	-	2757379..2758329 (-)	951	WP_015417820.1	magnesium transporter CorA family protein	-
AB0R72_RS13505 (AB0R72_13510)	-	2758475..2759776 (+)	1302	WP_241457553.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16254.72 Da
• Isoelectric Point: 10.2172

>NTDB_id=1020202 AB0R72_RS13480 WP_094032243.1 2754353..2754790(-) (comGD) [Bacillus velezensis strain AP46]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPACTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHRYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1020202 AB0R72_RS13480 WP_094032243.1 2754353..2754790(-) (comGD) [Bacillus velezensis strain AP46]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACAGTTTTGTTCACGACGGTTCCGCCGGCCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAGATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGTGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566