Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R72_RS13430 | Genome accession | NZ_CP160229 |
| Coordinates | 2749737..2749910 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain AP46 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2744737..2754910
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R72_RS13415 (AB0R72_13420) | gcvT | 2745550..2746650 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R72_RS13420 (AB0R72_13425) | - | 2747074..2748744 (+) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| AB0R72_RS13425 (AB0R72_13430) | - | 2748766..2749560 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| AB0R72_RS13430 (AB0R72_13435) | sinI | 2749737..2749910 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R72_RS13435 (AB0R72_13440) | sinR | 2749944..2750279 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R72_RS13440 (AB0R72_13445) | tasA | 2750327..2751112 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R72_RS13445 (AB0R72_13450) | sipW | 2751177..2751761 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| AB0R72_RS13450 (AB0R72_13455) | tapA | 2751733..2752404 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R72_RS13455 (AB0R72_13460) | - | 2752663..2752992 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB0R72_RS13460 (AB0R72_13465) | - | 2753032..2753211 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R72_RS13465 (AB0R72_13470) | comGG | 2753268..2753645 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R72_RS13470 (AB0R72_13475) | comGF | 2753646..2754146 (-) | 501 | WP_254922226.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R72_RS13475 (AB0R72_13480) | comGE | 2754055..2754369 (-) | 315 | WP_094032244.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R72_RS13480 (AB0R72_13485) | comGD | 2754353..2754790 (-) | 438 | WP_094032243.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1020199 AB0R72_RS13430 WP_003153105.1 2749737..2749910(+) (sinI) [Bacillus velezensis strain AP46]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1020199 AB0R72_RS13430 WP_003153105.1 2749737..2749910(+) (sinI) [Bacillus velezensis strain AP46]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |