Detailed information NTG1020057

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: AB0R77_RS11655
• Genome accession: NZ_CP160226
• Coordinates: 2260275..2260568 (-)
• Length: 97 a.a.
• NCBI ID: WP_024422977.1
• Uniprot ID: A0A0M2EIN6
• Organism: Bacillus safensis strain JJ1244
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2255275..2265568

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R77_RS11605 (AB0R77_11605)	sinR	2255439..2255774 (+)	336	WP_024422969.1	transcriptional regulator SinR	Regulator
AB0R77_RS11610 (AB0R77_11610)	tasA	2255842..2256642 (-)	801	WP_034280222.1	biofilm matrix protein TasA	-
AB0R77_RS11615 (AB0R77_11615)	sipW	2256700..2257272 (-)	573	WP_034280218.1	signal peptidase I SipW	-
AB0R77_RS11620 (AB0R77_11620)	tapA	2257325..2257852 (-)	528	WP_046311747.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R77_RS11625 (AB0R77_11625)	-	2258152..2258430 (+)	279	WP_061109527.1	DUF3889 domain-containing protein	-
AB0R77_RS11630 (AB0R77_11630)	-	2258465..2258659 (-)	195	WP_046311750.1	YqzE family protein	-
AB0R77_RS11635 (AB0R77_11635)	comGG	2258719..2259102 (-)	384	WP_041117969.1	competence type IV pilus minor pilin ComGG	-
AB0R77_RS11640 (AB0R77_11640)	comGF	2259099..2259626 (-)	528	WP_259407219.1	competence type IV pilus minor pilin ComGF	-
AB0R77_RS11645 (AB0R77_11645)	comGE	2259538..2259852 (-)	315	WP_041106865.1	competence type IV pilus minor pilin ComGE	-
AB0R77_RS11650 (AB0R77_11650)	comGD	2259836..2260282 (-)	447	WP_046311754.1	competence type IV pilus minor pilin ComGD	-
AB0R77_RS11655 (AB0R77_11655)	comGC	2260275..2260568 (-)	294	WP_024422977.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R77_RS11660 (AB0R77_11660)	comGB	2260585..2261625 (-)	1041	WP_046311756.1	competence type IV pilus assembly protein ComGB	-
AB0R77_RS11665 (AB0R77_11665)	comGA	2261606..2262676 (-)	1071	WP_041117979.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R77_RS11670 (AB0R77_11670)	-	2262854..2263729 (-)	876	WP_024422979.1	STAS domain-containing protein	-
AB0R77_RS11680 (AB0R77_11680)	-	2263953..2264333 (-)	381	WP_007501232.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
AB0R77_RS11685 (AB0R77_11685)	-	2264546..2264788 (+)	243	WP_003217440.1	DUF2626 domain-containing protein	-
AB0R77_RS11690 (AB0R77_11690)	-	2264834..2265472 (-)	639	WP_046311761.1	MBL fold metallo-hydrolase	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 10686.62 Da
• Isoelectric Point: 7.3218

>NTDB_id=1020057 AB0R77_RS11655 WP_024422977.1 2260275..2260568(-) (comGC) [Bacillus safensis strain JJ1244]
MNDKGFTLLEMLIVMLVISILLLITIPNITRHHQAIQAKGCEGLKSMVSTQVMAYELEHDGKTPSLAELEKEGYVKKGLT
CPNGKAIVIQNGNVKHE

Nucleotide

• Length: 294 bp

>NTDB_id=1020057 AB0R77_RS11655 WP_024422977.1 2260275..2260568(-) (comGC) [Bacillus safensis strain JJ1244]
ATGAATGATAAAGGATTTACCCTGTTAGAAATGTTAATAGTCATGCTTGTAATATCCATTCTTTTACTCATTACCATACC
GAATATTACACGTCATCACCAAGCTATTCAGGCAAAGGGCTGTGAAGGGCTTAAATCAATGGTCAGCACACAAGTGATGG
CATATGAATTGGAGCATGATGGGAAGACGCCATCTTTAGCTGAATTAGAAAAAGAAGGTTATGTCAAAAAAGGATTAACT
TGTCCTAATGGAAAAGCGATTGTCATTCAAAACGGCAACGTGAAGCATGAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: A0A0M2EIN6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Bacillus subtilis subsp. subtilis str. 168	67.01	100	0.67
comGC	Staphylococcus aureus MW2	42.222	92.784	0.392
comGC	Staphylococcus aureus N315	42.222	92.784	0.392