Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AB0R82_RS16180 Genome accession   NZ_CP160220
Coordinates   3119152..3119292 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain JM553     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3114152..3124292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R82_RS16155 (AB0R82_16155) yuxO 3114429..3114809 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  AB0R82_RS16160 (AB0R82_16160) comA 3114828..3115472 (-) 645 WP_366591747.1 two-component system response regulator ComA Regulator
  AB0R82_RS16165 (AB0R82_16165) comP 3115553..3117865 (-) 2313 WP_077671126.1 histidine kinase Regulator
  AB0R82_RS16170 (AB0R82_16170) comX 3117881..3118102 (-) 222 WP_014480704.1 competence pheromone ComX -
  AB0R82_RS16175 (AB0R82_16175) - 3118104..3118967 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  AB0R82_RS16180 (AB0R82_16180) degQ 3119152..3119292 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AB0R82_RS16185 (AB0R82_16185) - 3119514..3119639 (+) 126 WP_121549029.1 hypothetical protein -
  AB0R82_RS16190 (AB0R82_16190) - 3119754..3120122 (+) 369 WP_038427878.1 hypothetical protein -
  AB0R82_RS16195 (AB0R82_16195) pdeH 3120098..3121327 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AB0R82_RS16200 (AB0R82_16200) pncB 3121464..3122936 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AB0R82_RS16205 (AB0R82_16205) pncA 3122952..3123503 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  AB0R82_RS16210 (AB0R82_16210) yueI 3123600..3123998 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1019719 AB0R82_RS16180 WP_003220708.1 3119152..3119292(-) (degQ) [Bacillus subtilis strain JM553]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1019719 AB0R82_RS16180 WP_003220708.1 3119152..3119292(-) (degQ) [Bacillus subtilis strain JM553]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment