Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R89_RS11870 | Genome accession | NZ_CP160218 |
| Coordinates | 2531423..2531596 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain AP45 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2526423..2536596
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R89_RS11855 (AB0R89_11855) | gcvT | 2527236..2528336 (-) | 1101 | WP_043020790.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R89_RS11860 (AB0R89_11860) | - | 2528760..2530430 (+) | 1671 | WP_043020789.1 | SNF2-related protein | - |
| AB0R89_RS11865 (AB0R89_11865) | - | 2530452..2531246 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| AB0R89_RS11870 (AB0R89_11870) | sinI | 2531423..2531596 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R89_RS11875 (AB0R89_11875) | sinR | 2531630..2531965 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R89_RS11880 (AB0R89_11880) | tasA | 2532013..2532798 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R89_RS11885 (AB0R89_11885) | sipW | 2532863..2533447 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| AB0R89_RS11890 (AB0R89_11890) | tapA | 2533419..2534090 (-) | 672 | WP_020956077.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R89_RS11895 (AB0R89_11895) | - | 2534349..2534678 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB0R89_RS11900 (AB0R89_11900) | - | 2534719..2534898 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R89_RS11905 (AB0R89_11905) | comGG | 2534955..2535332 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R89_RS11910 (AB0R89_11910) | comGF | 2535333..2535833 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R89_RS11915 (AB0R89_11915) | comGE | 2535742..2536056 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R89_RS11920 (AB0R89_11920) | comGD | 2536040..2536477 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1019544 AB0R89_RS11870 WP_003153105.1 2531423..2531596(+) (sinI) [Bacillus velezensis strain AP45]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1019544 AB0R89_RS11870 WP_003153105.1 2531423..2531596(+) (sinI) [Bacillus velezensis strain AP45]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |