Detailed information NTG1019547

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R89_RS11920
• Genome accession: NZ_CP160218
• Coordinates: 2536040..2536477 (-)
• Length: 145 a.a.
• NCBI ID: WP_043020787.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain AP45
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2531040..2541477

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R89_RS11870 (AB0R89_11870)	sinI	2531423..2531596 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB0R89_RS11875 (AB0R89_11875)	sinR	2531630..2531965 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R89_RS11880 (AB0R89_11880)	tasA	2532013..2532798 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB0R89_RS11885 (AB0R89_11885)	sipW	2532863..2533447 (-)	585	WP_015240205.1	signal peptidase I SipW	-
AB0R89_RS11890 (AB0R89_11890)	tapA	2533419..2534090 (-)	672	WP_020956077.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R89_RS11895 (AB0R89_11895)	-	2534349..2534678 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
AB0R89_RS11900 (AB0R89_11900)	-	2534719..2534898 (-)	180	WP_003153093.1	YqzE family protein	-
AB0R89_RS11905 (AB0R89_11905)	comGG	2534955..2535332 (-)	378	WP_012117980.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R89_RS11910 (AB0R89_11910)	comGF	2535333..2535833 (-)	501	WP_257474763.1	competence type IV pilus minor pilin ComGF	-
AB0R89_RS11915 (AB0R89_11915)	comGE	2535742..2536056 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
AB0R89_RS11920 (AB0R89_11920)	comGD	2536040..2536477 (-)	438	WP_043020787.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R89_RS11925 (AB0R89_11925)	comGC	2536467..2536775 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R89_RS11930 (AB0R89_11930)	comGB	2536780..2537817 (-)	1038	WP_043020786.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R89_RS11935 (AB0R89_11935)	comGA	2537804..2538874 (-)	1071	WP_043020785.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R89_RS11940 (AB0R89_11940)	-	2539071..2540021 (-)	951	WP_007408319.1	magnesium transporter CorA family protein	-
AB0R89_RS11945 (AB0R89_11945)	-	2540167..2541468 (+)	1302	WP_043020784.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16271.77 Da
• Isoelectric Point: 10.2475

>NTDB_id=1019547 AB0R89_RS11920 WP_043020787.1 2536040..2536477(-) (comGD) [Bacillus velezensis strain AP45]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1019547 AB0R89_RS11920 WP_043020787.1 2536040..2536477(-) (comGD) [Bacillus velezensis strain AP45]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566