Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AB0R74_RS11795 Genome accession   NZ_CP160216
Coordinates   2448505..2448882 (-) Length   125 a.a.
NCBI ID   WP_335536808.1    Uniprot ID   -
Organism   Bacillus velezensis strain JJ1043     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2443505..2453882
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R74_RS11755 (AB0R74_11755) - 2444003..2444797 (+) 795 WP_007408330.1 YqhG family protein -
  AB0R74_RS11760 (AB0R74_11760) sinI 2444974..2445147 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R74_RS11765 (AB0R74_11765) sinR 2445181..2445516 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R74_RS11770 (AB0R74_11770) tasA 2445564..2446349 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R74_RS11775 (AB0R74_11775) sipW 2446414..2446998 (-) 585 WP_015240205.1 signal peptidase I SipW -
  AB0R74_RS11780 (AB0R74_11780) tapA 2446970..2447641 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R74_RS11785 (AB0R74_11785) - 2447900..2448229 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  AB0R74_RS11790 (AB0R74_11790) - 2448269..2448448 (-) 180 WP_003153093.1 YqzE family protein -
  AB0R74_RS11795 (AB0R74_11795) comGG 2448505..2448882 (-) 378 WP_335536808.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R74_RS11800 (AB0R74_11800) comGF 2448883..2449383 (-) 501 WP_327992268.1 competence type IV pilus minor pilin ComGF -
  AB0R74_RS11805 (AB0R74_11805) comGE 2449292..2449606 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  AB0R74_RS11810 (AB0R74_11810) comGD 2449590..2450027 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB0R74_RS11815 (AB0R74_11815) comGC 2450017..2450325 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB0R74_RS11820 (AB0R74_11820) comGB 2450330..2451367 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB0R74_RS11825 (AB0R74_11825) comGA 2451354..2452424 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  AB0R74_RS11830 (AB0R74_11830) - 2452616..2453566 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14152.03 Da        Isoelectric Point: 9.7381

>NTDB_id=1019394 AB0R74_RS11795 WP_335536808.1 2448505..2448882(-) (comGG) [Bacillus velezensis strain JJ1043]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTPGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1019394 AB0R74_RS11795 WP_335536808.1 2448505..2448882(-) (comGG) [Bacillus velezensis strain JJ1043]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACCGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment