Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R74_RS11760 | Genome accession | NZ_CP160216 |
| Coordinates | 2444974..2445147 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JJ1043 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2439974..2450147
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R74_RS11745 (AB0R74_11745) | gcvT | 2440787..2441887 (-) | 1101 | WP_007408332.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R74_RS11750 (AB0R74_11750) | - | 2442311..2443981 (+) | 1671 | WP_053103982.1 | SNF2-related protein | - |
| AB0R74_RS11755 (AB0R74_11755) | - | 2444003..2444797 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| AB0R74_RS11760 (AB0R74_11760) | sinI | 2444974..2445147 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R74_RS11765 (AB0R74_11765) | sinR | 2445181..2445516 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R74_RS11770 (AB0R74_11770) | tasA | 2445564..2446349 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R74_RS11775 (AB0R74_11775) | sipW | 2446414..2446998 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| AB0R74_RS11780 (AB0R74_11780) | tapA | 2446970..2447641 (-) | 672 | WP_031378945.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R74_RS11785 (AB0R74_11785) | - | 2447900..2448229 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| AB0R74_RS11790 (AB0R74_11790) | - | 2448269..2448448 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R74_RS11795 (AB0R74_11795) | comGG | 2448505..2448882 (-) | 378 | WP_335536808.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R74_RS11800 (AB0R74_11800) | comGF | 2448883..2449383 (-) | 501 | WP_327992268.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R74_RS11805 (AB0R74_11805) | comGE | 2449292..2449606 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R74_RS11810 (AB0R74_11810) | comGD | 2449590..2450027 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1019392 AB0R74_RS11760 WP_003153105.1 2444974..2445147(+) (sinI) [Bacillus velezensis strain JJ1043]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1019392 AB0R74_RS11760 WP_003153105.1 2444974..2445147(+) (sinI) [Bacillus velezensis strain JJ1043]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |