Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R79_RS12990 | Genome accession | NZ_CP160211 |
| Coordinates | 2646958..2647131 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JM236 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2641958..2652131
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R79_RS12975 (AB0R79_12975) | gcvT | 2642771..2643871 (-) | 1101 | WP_366597573.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R79_RS12980 (AB0R79_12980) | - | 2644295..2645965 (+) | 1671 | WP_108655005.1 | SNF2-related protein | - |
| AB0R79_RS12985 (AB0R79_12985) | - | 2645987..2646781 (+) | 795 | WP_015240204.1 | YqhG family protein | - |
| AB0R79_RS12990 (AB0R79_12990) | sinI | 2646958..2647131 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R79_RS12995 (AB0R79_12995) | sinR | 2647165..2647500 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R79_RS13000 (AB0R79_13000) | tasA | 2647548..2648333 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R79_RS13005 (AB0R79_13005) | sipW | 2648398..2648982 (-) | 585 | WP_025284996.1 | signal peptidase I SipW | - |
| AB0R79_RS13010 (AB0R79_13010) | tapA | 2648954..2649625 (-) | 672 | WP_015240206.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R79_RS13015 (AB0R79_13015) | - | 2649884..2650213 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB0R79_RS13020 (AB0R79_13020) | - | 2650253..2650432 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R79_RS13025 (AB0R79_13025) | comGG | 2650489..2650866 (-) | 378 | WP_167340753.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R79_RS13030 (AB0R79_13030) | comGF | 2650867..2651367 (-) | 501 | WP_257720329.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R79_RS13035 (AB0R79_13035) | comGE | 2651276..2651590 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R79_RS13040 (AB0R79_13040) | comGD | 2651574..2652011 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1019014 AB0R79_RS12990 WP_003153105.1 2646958..2647131(+) (sinI) [Bacillus velezensis strain JM236]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1019014 AB0R79_RS12990 WP_003153105.1 2646958..2647131(+) (sinI) [Bacillus velezensis strain JM236]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |