Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ABNX04_RS12010 Genome accession   NZ_CP159868
Coordinates   2533060..2533374 (-) Length   104 a.a.
NCBI ID   WP_038459179.1    Uniprot ID   -
Organism   Bacillus velezensis strain JLU-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2528060..2538374
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABNX04_RS11965 (ABNX04_11965) sinI 2528741..2528914 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  ABNX04_RS11970 (ABNX04_11970) sinR 2528948..2529283 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABNX04_RS11975 (ABNX04_11975) tasA 2529331..2530116 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ABNX04_RS11980 (ABNX04_11980) sipW 2530181..2530765 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ABNX04_RS11985 (ABNX04_11985) tapA 2530737..2531408 (-) 672 WP_038459173.1 amyloid fiber anchoring/assembly protein TapA -
  ABNX04_RS11990 (ABNX04_11990) - 2531667..2531996 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  ABNX04_RS11995 (ABNX04_11995) - 2532037..2532216 (-) 180 WP_022552966.1 YqzE family protein -
  ABNX04_RS12000 (ABNX04_12000) comGG 2532273..2532650 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABNX04_RS12005 (ABNX04_12005) comGF 2532651..2533151 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  ABNX04_RS12010 (ABNX04_12010) comGE 2533060..2533374 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABNX04_RS12015 (ABNX04_12015) comGD 2533358..2533795 (-) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABNX04_RS12020 (ABNX04_12020) comGC 2533785..2534093 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ABNX04_RS12025 (ABNX04_12025) comGB 2534098..2535135 (-) 1038 WP_038459183.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABNX04_RS12030 (ABNX04_12030) comGA 2535122..2536192 (-) 1071 WP_038459186.1 competence type IV pilus ATPase ComGA Machinery gene
  ABNX04_RS12035 (ABNX04_12035) - 2536389..2537339 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11932.91 Da        Isoelectric Point: 5.8321

>NTDB_id=1016285 ABNX04_RS12010 WP_038459179.1 2533060..2533374(-) (comGE) [Bacillus velezensis strain JLU-1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1016285 ABNX04_RS12010 WP_038459179.1 2533060..2533374(-) (comGE) [Bacillus velezensis strain JLU-1]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment