Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ABNX04_RS11965 Genome accession   NZ_CP159868
Coordinates   2528741..2528914 (+) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus velezensis strain JLU-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2523741..2533914
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABNX04_RS11950 (ABNX04_11950) gcvT 2524554..2525654 (-) 1101 WP_038459167.1 glycine cleavage system aminomethyltransferase GcvT -
  ABNX04_RS11955 (ABNX04_11955) - 2526078..2527748 (+) 1671 WP_038459170.1 SNF2-related protein -
  ABNX04_RS11960 (ABNX04_11960) - 2527770..2528564 (+) 795 WP_007612541.1 YqhG family protein -
  ABNX04_RS11965 (ABNX04_11965) sinI 2528741..2528914 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  ABNX04_RS11970 (ABNX04_11970) sinR 2528948..2529283 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABNX04_RS11975 (ABNX04_11975) tasA 2529331..2530116 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ABNX04_RS11980 (ABNX04_11980) sipW 2530181..2530765 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ABNX04_RS11985 (ABNX04_11985) tapA 2530737..2531408 (-) 672 WP_038459173.1 amyloid fiber anchoring/assembly protein TapA -
  ABNX04_RS11990 (ABNX04_11990) - 2531667..2531996 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  ABNX04_RS11995 (ABNX04_11995) - 2532037..2532216 (-) 180 WP_022552966.1 YqzE family protein -
  ABNX04_RS12000 (ABNX04_12000) comGG 2532273..2532650 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABNX04_RS12005 (ABNX04_12005) comGF 2532651..2533151 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  ABNX04_RS12010 (ABNX04_12010) comGE 2533060..2533374 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABNX04_RS12015 (ABNX04_12015) comGD 2533358..2533795 (-) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=1016282 ABNX04_RS11965 WP_007612543.1 2528741..2528914(+) (sinI) [Bacillus velezensis strain JLU-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1016282 ABNX04_RS11965 WP_007612543.1 2528741..2528914(+) (sinI) [Bacillus velezensis strain JLU-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment