Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ABQ274_RS10545 Genome accession   NZ_CP159281
Coordinates   2105855..2106253 (+) Length   132 a.a.
NCBI ID   WP_023164614.1    Uniprot ID   -
Organism   Lactococcus lactis strain FNZ339     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2071185..2107771 2105855..2106253 within 0


Gene organization within MGE regions


Location: 2071185..2107771
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABQ274_RS10290 (ABQ274_10290) - 2071185..2072642 (-) 1458 WP_353726874.1 recombinase family protein -
  ABQ274_RS10295 (ABQ274_10295) - 2072762..2073301 (-) 540 WP_023164651.1 PH domain-containing protein -
  ABQ274_RS10300 (ABQ274_10300) - 2073356..2073940 (-) 585 WP_259771878.1 hypothetical protein -
  ABQ274_RS10305 (ABQ274_10305) - 2073951..2074358 (-) 408 WP_023189013.1 helix-turn-helix transcriptional regulator -
  ABQ274_RS10310 (ABQ274_10310) - 2074535..2074768 (+) 234 WP_353726875.1 hypothetical protein -
  ABQ274_RS10315 (ABQ274_10315) - 2074827..2075516 (+) 690 WP_353726876.1 Rha family transcriptional regulator -
  ABQ274_RS10320 (ABQ274_10320) - 2075532..2075714 (+) 183 WP_003130605.1 hypothetical protein -
  ABQ274_RS10325 (ABQ274_10325) - 2075711..2075833 (+) 123 WP_023164646.1 hypothetical protein -
  ABQ274_RS10330 (ABQ274_10330) - 2075846..2076088 (+) 243 WP_353726877.1 hypothetical protein -
  ABQ274_RS10335 (ABQ274_10335) bet 2076193..2076930 (+) 738 WP_211752879.1 phage recombination protein Bet -
  ABQ274_RS10340 (ABQ274_10340) - 2076932..2077948 (+) 1017 WP_031558902.1 DUF1351 domain-containing protein -
  ABQ274_RS10345 (ABQ274_10345) - 2077952..2078182 (+) 231 WP_353726878.1 hypothetical protein -
  ABQ274_RS10350 (ABQ274_10350) - 2078213..2079127 (+) 915 WP_014570812.1 phage replisome organizer N-terminal domain-containing protein -
  ABQ274_RS10355 (ABQ274_10355) - 2079120..2079362 (+) 243 WP_023188824.1 L-rhamnose isomerase -
  ABQ274_RS10360 (ABQ274_10360) - 2079375..2079785 (+) 411 WP_014570810.1 hypothetical protein -
  ABQ274_RS10365 (ABQ274_10365) - 2079893..2080099 (+) 207 WP_014570535.1 hypothetical protein -
  ABQ274_RS10370 (ABQ274_10370) - 2080291..2080650 (+) 360 WP_150890987.1 hypothetical protein -
  ABQ274_RS10375 (ABQ274_10375) - 2080643..2081302 (+) 660 WP_353726879.1 DUF1642 domain-containing protein -
  ABQ274_RS10380 (ABQ274_10380) - 2081299..2081718 (+) 420 WP_353726880.1 dUTP diphosphatase -
  ABQ274_RS10385 (ABQ274_10385) - 2081722..2082066 (+) 345 WP_353726881.1 hypothetical protein -
  ABQ274_RS10390 (ABQ274_10390) - 2082088..2082423 (+) 336 WP_353726882.1 DUF1140 family protein -
  ABQ274_RS10395 (ABQ274_10395) - 2082442..2082681 (+) 240 WP_353726883.1 hypothetical protein -
  ABQ274_RS10400 (ABQ274_10400) - 2082678..2082842 (+) 165 WP_353726884.1 DUF1660 domain-containing protein -
  ABQ274_RS10405 (ABQ274_10405) - 2082842..2083003 (+) 162 WP_023164357.1 hypothetical protein -
  ABQ274_RS10410 (ABQ274_10410) - 2083084..2083293 (-) 210 WP_021722221.1 hypothetical protein -
  ABQ274_RS10415 (ABQ274_10415) - 2083752..2084141 (+) 390 WP_031561062.1 DUF722 domain-containing protein -
  ABQ274_RS10420 (ABQ274_10420) - 2084574..2084735 (+) 162 Protein_2011 HNH endonuclease -
  ABQ274_RS10425 (ABQ274_10425) - 2084901..2085122 (+) 222 Protein_2012 helix-turn-helix domain-containing protein -
  ABQ274_RS10430 (ABQ274_10430) terL 2085103..2086554 (+) 1452 WP_095345920.1 phage terminase large subunit -
  ABQ274_RS10435 (ABQ274_10435) - 2086567..2088096 (+) 1530 WP_353726885.1 phage portal protein -
  ABQ274_RS10440 (ABQ274_10440) - 2088089..2088919 (+) 831 WP_353726886.1 phage minor head protein -
  ABQ274_RS10445 (ABQ274_10445) - 2088935..2089984 (+) 1050 WP_277812515.1 XkdF-like putative serine protease domain-containing protein -
  ABQ274_RS10450 (ABQ274_10450) - 2089999..2090916 (+) 918 WP_003131315.1 hypothetical protein -
  ABQ274_RS10455 (ABQ274_10455) - 2090945..2091181 (+) 237 WP_014570555.1 Ig-like domain-containing protein -
  ABQ274_RS10460 (ABQ274_10460) - 2091255..2091623 (+) 369 WP_353726887.1 hypothetical protein -
  ABQ274_RS10465 (ABQ274_10465) - 2091645..2091989 (+) 345 WP_014570557.1 putative minor capsid protein -
  ABQ274_RS10470 (ABQ274_10470) - 2091986..2092315 (+) 330 WP_003131320.1 hypothetical protein -
  ABQ274_RS10475 (ABQ274_10475) - 2092315..2092749 (+) 435 WP_353726888.1 minor capsid protein -
  ABQ274_RS10480 (ABQ274_10480) - 2092760..2093236 (+) 477 WP_014570559.1 hypothetical protein -
  ABQ274_RS10485 (ABQ274_10485) - 2093293..2093700 (+) 408 WP_003131323.1 hypothetical protein -
  ABQ274_RS10490 (ABQ274_10490) - 2093716..2094423 (+) 708 WP_031561043.1 Gp15 family bacteriophage protein -
  ABQ274_RS10495 (ABQ274_10495) - 2094413..2097016 (+) 2604 WP_353726889.1 phage tail tape measure protein -
  ABQ274_RS10500 (ABQ274_10500) - 2097030..2098553 (+) 1524 WP_353726890.1 distal tail protein Dit -
  ABQ274_RS10505 (ABQ274_10505) - 2098553..2100547 (+) 1995 WP_353726891.1 hypothetical protein -
  ABQ274_RS10510 (ABQ274_10510) - 2100984..2102999 (+) 2016 WP_353727687.1 hypothetical protein -
  ABQ274_RS10515 (ABQ274_10515) - 2103013..2103243 (+) 231 WP_129300312.1 hypothetical protein -
  ABQ274_RS10520 (ABQ274_10520) - 2103256..2103606 (+) 351 WP_023164508.1 hypothetical protein -
  ABQ274_RS10525 (ABQ274_10525) - 2103619..2103906 (+) 288 WP_023164507.1 phage holin -
  ABQ274_RS10530 (ABQ274_10530) - 2103906..2104685 (+) 780 WP_353726892.1 peptidoglycan amidohydrolase family protein -
  ABQ274_RS10535 (ABQ274_10535) - 2104765..2105487 (+) 723 WP_353726893.1 hypothetical protein -
  ABQ274_RS10540 (ABQ274_10540) comGC 2105593..2105862 (+) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  ABQ274_RS10545 (ABQ274_10545) comGD 2105855..2106253 (+) 399 WP_023164614.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABQ274_RS10550 (ABQ274_10550) comGE 2106225..2106521 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABQ274_RS10555 (ABQ274_10555) comGF 2106484..2106930 (+) 447 WP_031558968.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABQ274_RS10560 (ABQ274_10560) comGG 2106969..2107253 (+) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABQ274_RS10565 (ABQ274_10565) - 2107334..2107771 (+) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -

Sequence


Protein


Download         Length: 132 a.a.        Molecular weight: 15161.74 Da        Isoelectric Point: 7.9839

>NTDB_id=1013070 ABQ274_RS10545 WP_023164614.1 2105855..2106253(+) (comGD) [Lactococcus lactis strain FNZ339]
MTKAFTLLESLLVLLITSFITTLFSLEIIQTIHLFKGELFVLQFENFYKRSQEDAALLQKSESLVAKNQELICEDRSITI
PKEVAVKDFTVKFDDKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS

Nucleotide


Download         Length: 399 bp        

>NTDB_id=1013070 ABQ274_RS10545 WP_023164614.1 2105855..2106253(+) (comGD) [Lactococcus lactis strain FNZ339]
ATGACTAAAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGATTACTTCTTTTATCACAACTCTTTTTTCTTTAGA
AATAATACAAACAATCCATCTTTTTAAGGGAGAATTGTTTGTTCTTCAATTTGAAAATTTCTATAAAAGGAGTCAAGAAG
ATGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAAGAATTAATCTGTGAAGATAGAAGTATCACAATT
CCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAAGGGAGAGAATTCTAGCTTACAAAAACTCACAAT
TTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAGGCAGTGGAAAATTTAAAAAGAAAATCAGTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

67.424

100

0.674

  comYD Streptococcus mutans UA140

41.406

96.97

0.402

  comYD Streptococcus mutans UA159

41.406

96.97

0.402

  comYD Streptococcus gordonii str. Challis substr. CH1

40.625

96.97

0.394


Multiple sequence alignment