Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | ABQ274_RS10560 | Genome accession | NZ_CP159281 |
| Coordinates | 2106969..2107253 (+) | Length | 94 a.a. |
| NCBI ID | WP_010906314.1 | Uniprot ID | A0AAC9R304 |
| Organism | Lactococcus lactis strain FNZ339 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2071185..2107771 | 2106969..2107253 | within | 0 |
Gene organization within MGE regions
Location: 2071185..2107771
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABQ274_RS10290 (ABQ274_10290) | - | 2071185..2072642 (-) | 1458 | WP_353726874.1 | recombinase family protein | - |
| ABQ274_RS10295 (ABQ274_10295) | - | 2072762..2073301 (-) | 540 | WP_023164651.1 | PH domain-containing protein | - |
| ABQ274_RS10300 (ABQ274_10300) | - | 2073356..2073940 (-) | 585 | WP_259771878.1 | hypothetical protein | - |
| ABQ274_RS10305 (ABQ274_10305) | - | 2073951..2074358 (-) | 408 | WP_023189013.1 | helix-turn-helix transcriptional regulator | - |
| ABQ274_RS10310 (ABQ274_10310) | - | 2074535..2074768 (+) | 234 | WP_353726875.1 | hypothetical protein | - |
| ABQ274_RS10315 (ABQ274_10315) | - | 2074827..2075516 (+) | 690 | WP_353726876.1 | Rha family transcriptional regulator | - |
| ABQ274_RS10320 (ABQ274_10320) | - | 2075532..2075714 (+) | 183 | WP_003130605.1 | hypothetical protein | - |
| ABQ274_RS10325 (ABQ274_10325) | - | 2075711..2075833 (+) | 123 | WP_023164646.1 | hypothetical protein | - |
| ABQ274_RS10330 (ABQ274_10330) | - | 2075846..2076088 (+) | 243 | WP_353726877.1 | hypothetical protein | - |
| ABQ274_RS10335 (ABQ274_10335) | bet | 2076193..2076930 (+) | 738 | WP_211752879.1 | phage recombination protein Bet | - |
| ABQ274_RS10340 (ABQ274_10340) | - | 2076932..2077948 (+) | 1017 | WP_031558902.1 | DUF1351 domain-containing protein | - |
| ABQ274_RS10345 (ABQ274_10345) | - | 2077952..2078182 (+) | 231 | WP_353726878.1 | hypothetical protein | - |
| ABQ274_RS10350 (ABQ274_10350) | - | 2078213..2079127 (+) | 915 | WP_014570812.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ABQ274_RS10355 (ABQ274_10355) | - | 2079120..2079362 (+) | 243 | WP_023188824.1 | L-rhamnose isomerase | - |
| ABQ274_RS10360 (ABQ274_10360) | - | 2079375..2079785 (+) | 411 | WP_014570810.1 | hypothetical protein | - |
| ABQ274_RS10365 (ABQ274_10365) | - | 2079893..2080099 (+) | 207 | WP_014570535.1 | hypothetical protein | - |
| ABQ274_RS10370 (ABQ274_10370) | - | 2080291..2080650 (+) | 360 | WP_150890987.1 | hypothetical protein | - |
| ABQ274_RS10375 (ABQ274_10375) | - | 2080643..2081302 (+) | 660 | WP_353726879.1 | DUF1642 domain-containing protein | - |
| ABQ274_RS10380 (ABQ274_10380) | - | 2081299..2081718 (+) | 420 | WP_353726880.1 | dUTP diphosphatase | - |
| ABQ274_RS10385 (ABQ274_10385) | - | 2081722..2082066 (+) | 345 | WP_353726881.1 | hypothetical protein | - |
| ABQ274_RS10390 (ABQ274_10390) | - | 2082088..2082423 (+) | 336 | WP_353726882.1 | DUF1140 family protein | - |
| ABQ274_RS10395 (ABQ274_10395) | - | 2082442..2082681 (+) | 240 | WP_353726883.1 | hypothetical protein | - |
| ABQ274_RS10400 (ABQ274_10400) | - | 2082678..2082842 (+) | 165 | WP_353726884.1 | DUF1660 domain-containing protein | - |
| ABQ274_RS10405 (ABQ274_10405) | - | 2082842..2083003 (+) | 162 | WP_023164357.1 | hypothetical protein | - |
| ABQ274_RS10410 (ABQ274_10410) | - | 2083084..2083293 (-) | 210 | WP_021722221.1 | hypothetical protein | - |
| ABQ274_RS10415 (ABQ274_10415) | - | 2083752..2084141 (+) | 390 | WP_031561062.1 | DUF722 domain-containing protein | - |
| ABQ274_RS10420 (ABQ274_10420) | - | 2084574..2084735 (+) | 162 | Protein_2011 | HNH endonuclease | - |
| ABQ274_RS10425 (ABQ274_10425) | - | 2084901..2085122 (+) | 222 | Protein_2012 | helix-turn-helix domain-containing protein | - |
| ABQ274_RS10430 (ABQ274_10430) | terL | 2085103..2086554 (+) | 1452 | WP_095345920.1 | phage terminase large subunit | - |
| ABQ274_RS10435 (ABQ274_10435) | - | 2086567..2088096 (+) | 1530 | WP_353726885.1 | phage portal protein | - |
| ABQ274_RS10440 (ABQ274_10440) | - | 2088089..2088919 (+) | 831 | WP_353726886.1 | phage minor head protein | - |
| ABQ274_RS10445 (ABQ274_10445) | - | 2088935..2089984 (+) | 1050 | WP_277812515.1 | XkdF-like putative serine protease domain-containing protein | - |
| ABQ274_RS10450 (ABQ274_10450) | - | 2089999..2090916 (+) | 918 | WP_003131315.1 | hypothetical protein | - |
| ABQ274_RS10455 (ABQ274_10455) | - | 2090945..2091181 (+) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| ABQ274_RS10460 (ABQ274_10460) | - | 2091255..2091623 (+) | 369 | WP_353726887.1 | hypothetical protein | - |
| ABQ274_RS10465 (ABQ274_10465) | - | 2091645..2091989 (+) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| ABQ274_RS10470 (ABQ274_10470) | - | 2091986..2092315 (+) | 330 | WP_003131320.1 | hypothetical protein | - |
| ABQ274_RS10475 (ABQ274_10475) | - | 2092315..2092749 (+) | 435 | WP_353726888.1 | minor capsid protein | - |
| ABQ274_RS10480 (ABQ274_10480) | - | 2092760..2093236 (+) | 477 | WP_014570559.1 | hypothetical protein | - |
| ABQ274_RS10485 (ABQ274_10485) | - | 2093293..2093700 (+) | 408 | WP_003131323.1 | hypothetical protein | - |
| ABQ274_RS10490 (ABQ274_10490) | - | 2093716..2094423 (+) | 708 | WP_031561043.1 | Gp15 family bacteriophage protein | - |
| ABQ274_RS10495 (ABQ274_10495) | - | 2094413..2097016 (+) | 2604 | WP_353726889.1 | phage tail tape measure protein | - |
| ABQ274_RS10500 (ABQ274_10500) | - | 2097030..2098553 (+) | 1524 | WP_353726890.1 | distal tail protein Dit | - |
| ABQ274_RS10505 (ABQ274_10505) | - | 2098553..2100547 (+) | 1995 | WP_353726891.1 | hypothetical protein | - |
| ABQ274_RS10510 (ABQ274_10510) | - | 2100984..2102999 (+) | 2016 | WP_353727687.1 | hypothetical protein | - |
| ABQ274_RS10515 (ABQ274_10515) | - | 2103013..2103243 (+) | 231 | WP_129300312.1 | hypothetical protein | - |
| ABQ274_RS10520 (ABQ274_10520) | - | 2103256..2103606 (+) | 351 | WP_023164508.1 | hypothetical protein | - |
| ABQ274_RS10525 (ABQ274_10525) | - | 2103619..2103906 (+) | 288 | WP_023164507.1 | phage holin | - |
| ABQ274_RS10530 (ABQ274_10530) | - | 2103906..2104685 (+) | 780 | WP_353726892.1 | peptidoglycan amidohydrolase family protein | - |
| ABQ274_RS10535 (ABQ274_10535) | - | 2104765..2105487 (+) | 723 | WP_353726893.1 | hypothetical protein | - |
| ABQ274_RS10540 (ABQ274_10540) | comGC | 2105593..2105862 (+) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ABQ274_RS10545 (ABQ274_10545) | comGD | 2105855..2106253 (+) | 399 | WP_023164614.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ABQ274_RS10550 (ABQ274_10550) | comGE | 2106225..2106521 (+) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ABQ274_RS10555 (ABQ274_10555) | comGF | 2106484..2106930 (+) | 447 | WP_031558968.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ABQ274_RS10560 (ABQ274_10560) | comGG | 2106969..2107253 (+) | 285 | WP_010906314.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABQ274_RS10565 (ABQ274_10565) | - | 2107334..2107771 (+) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10783.02 Da Isoelectric Point: 5.0604
>NTDB_id=1013073 ABQ274_RS10560 WP_010906314.1 2106969..2107253(+) (comGG) [Lactococcus lactis strain FNZ339]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
Nucleotide
Download Length: 285 bp
>NTDB_id=1013073 ABQ274_RS10560 WP_010906314.1 2106969..2107253(+) (comGG) [Lactococcus lactis strain FNZ339]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
59.14 |
98.936 |
0.585 |