Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ABUH86_RS11960 Genome accession   NZ_CP158669
Coordinates   2475437..2475814 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain XY40-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2470437..2480814
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABUH86_RS11920 (ABUH86_11920) - 2470934..2471728 (+) 795 WP_136396493.1 YqhG family protein -
  ABUH86_RS11925 (ABUH86_11925) sinI 2471905..2472078 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ABUH86_RS11930 (ABUH86_11930) sinR 2472112..2472447 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABUH86_RS11935 (ABUH86_11935) tasA 2472495..2473280 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ABUH86_RS11940 (ABUH86_11940) sipW 2473345..2473917 (-) 573 WP_136396777.1 signal peptidase I SipW -
  ABUH86_RS11945 (ABUH86_11945) tapA 2473901..2474572 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  ABUH86_RS11950 (ABUH86_11950) - 2474831..2475160 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ABUH86_RS11955 (ABUH86_11955) - 2475201..2475380 (-) 180 WP_003153093.1 YqzE family protein -
  ABUH86_RS11960 (ABUH86_11960) comGG 2475437..2475814 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABUH86_RS11965 (ABUH86_11965) comGF 2475815..2476315 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  ABUH86_RS11970 (ABUH86_11970) comGE 2476224..2476538 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ABUH86_RS11975 (ABUH86_11975) comGD 2476522..2476959 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABUH86_RS11980 (ABUH86_11980) comGC 2476949..2477257 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ABUH86_RS11985 (ABUH86_11985) comGB 2477262..2478299 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABUH86_RS11990 (ABUH86_11990) comGA 2478286..2479356 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ABUH86_RS11995 (ABUH86_11995) - 2479550..2480500 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=1011926 ABUH86_RS11960 WP_012117980.1 2475437..2475814(-) (comGG) [Bacillus velezensis strain XY40-1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1011926 ABUH86_RS11960 WP_012117980.1 2475437..2475814(-) (comGG) [Bacillus velezensis strain XY40-1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment