Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ABUH86_RS11925 Genome accession   NZ_CP158669
Coordinates   2471905..2472078 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain XY40-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2466905..2477078
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABUH86_RS11910 (ABUH86_11910) gcvT 2467718..2468818 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  ABUH86_RS11915 (ABUH86_11915) - 2469242..2470912 (+) 1671 WP_025284995.1 SNF2-related protein -
  ABUH86_RS11920 (ABUH86_11920) - 2470934..2471728 (+) 795 WP_136396493.1 YqhG family protein -
  ABUH86_RS11925 (ABUH86_11925) sinI 2471905..2472078 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ABUH86_RS11930 (ABUH86_11930) sinR 2472112..2472447 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABUH86_RS11935 (ABUH86_11935) tasA 2472495..2473280 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ABUH86_RS11940 (ABUH86_11940) sipW 2473345..2473917 (-) 573 WP_136396777.1 signal peptidase I SipW -
  ABUH86_RS11945 (ABUH86_11945) tapA 2473901..2474572 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  ABUH86_RS11950 (ABUH86_11950) - 2474831..2475160 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ABUH86_RS11955 (ABUH86_11955) - 2475201..2475380 (-) 180 WP_003153093.1 YqzE family protein -
  ABUH86_RS11960 (ABUH86_11960) comGG 2475437..2475814 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABUH86_RS11965 (ABUH86_11965) comGF 2475815..2476315 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  ABUH86_RS11970 (ABUH86_11970) comGE 2476224..2476538 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ABUH86_RS11975 (ABUH86_11975) comGD 2476522..2476959 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1011924 ABUH86_RS11925 WP_003153105.1 2471905..2472078(+) (sinI) [Bacillus velezensis strain XY40-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1011924 ABUH86_RS11925 WP_003153105.1 2471905..2472078(+) (sinI) [Bacillus velezensis strain XY40-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment