Detailed information NTG1011296

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: H1W84_RS08805
• Genome accession: NZ_LR822036
• Coordinates: 1694029..1694346 (-)
• Length: 105 a.a.
• NCBI ID: WP_002952035.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus isolate STH_CIRM_1055
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1689029..1699346

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H1W84_RS08775 (STHERMO_1952)	-	1689388..1690050 (-)	663	WP_011681679.1	CPBP family intramembrane glutamic endopeptidase	-
H1W84_RS08780 (STHERMO_1953)	-	1690147..1690590 (-)	444	WP_011681680.1	hypothetical protein	-
H1W84_RS10170 (STHERMO_1954)	-	1690664..1691089 (-)	426	WP_014608739.1	CPBP family intramembrane glutamic endopeptidase	-
H1W84_RS10175 (STHERMO_1955)	-	1691046..1691321 (-)	276	WP_011681681.1	hypothetical protein	-
H1W84_RS08790 (STHERMO_1956)	-	1691333..1691530 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
H1W84_RS08795 (STHERMO_1957)	-	1691779..1692972 (-)	1194	WP_014608740.1	acetate kinase	-
H1W84_RS08800 (STHERMO_1958)	comGH	1693028..1693984 (-)	957	WP_014608741.1	class I SAM-dependent methyltransferase	Machinery gene
H1W84_RS08805 (STHERMO_1959)	comGG	1694029..1694346 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	Machinery gene
H1W84_RS08810 (STHERMO_1960)	comGF	1694324..1694761 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
H1W84_RS08815 (STHERMO_1961)	comGE	1694745..1695038 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
H1W84_RS08820 (STHERMO_1962)	comGD	1695010..1695438 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
H1W84_RS08825 (STHERMO_1963)	comGC	1695398..1695724 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
H1W84_RS08830 (STHERMO_1964)	comGB	1695721..1696821 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
H1W84_RS08835 (STHERMO_1965)	comGA/cglA/cilD	1696703..1697644 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
H1W84_RS08840 (STHERMO_1966)	-	1697725..1698087 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11824.93 Da
• Isoelectric Point: 10.6334

>NTDB_id=1011296 H1W84_RS08805 WP_002952035.1 1694029..1694346(-) (comGG) [Streptococcus thermophilus isolate STH_CIRM_1055]
MLLKKQVRGGVLLYALFMAGIFTLLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVIVRVASKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=1011296 H1W84_RS08805 WP_002952035.1 1694029..1694346(-) (comGG) [Streptococcus thermophilus isolate STH_CIRM_1055]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTACACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGATTGTCAGAGTTGCCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae D39	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae R6	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae TIGR4	42.222	85.714	0.362