Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABNG17_RS15075 Genome accession   NZ_CP158181
Coordinates   2805781..2805921 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain RI06-95     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2800781..2810921
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABNG17_RS15050 (ABNG17_15035) - 2801046..2801435 (-) 390 WP_106066313.1 hotdog fold thioesterase -
  ABNG17_RS15055 (ABNG17_15040) comA 2801459..2802100 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  ABNG17_RS15060 (ABNG17_15045) comP 2802181..2804493 (-) 2313 WP_350303504.1 ATP-binding protein Regulator
  ABNG17_RS15065 (ABNG17_15050) comX 2804548..2804718 (-) 171 WP_212045489.1 competence pheromone ComX -
  ABNG17_RS15070 (ABNG17_15055) - 2804715..2805629 (-) 915 WP_212045490.1 polyprenyl synthetase family protein -
  ABNG17_RS15075 (ABNG17_15060) degQ 2805781..2805921 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ABNG17_RS15080 (ABNG17_15065) - 2806427..2806780 (+) 354 WP_050944043.1 hypothetical protein -
  ABNG17_RS15085 (ABNG17_15070) - 2806811..2808037 (-) 1227 WP_050944044.1 HDOD domain-containing protein -
  ABNG17_RS15090 (ABNG17_15075) - 2808178..2809647 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  ABNG17_RS15095 (ABNG17_15080) - 2809665..2810216 (-) 552 WP_003213138.1 isochorismatase family cysteine hydrolase -
  ABNG17_RS15100 (ABNG17_15085) - 2810277..2810684 (-) 408 WP_350303505.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1010147 ABNG17_RS15075 WP_003213123.1 2805781..2805921(-) (degQ) [Bacillus pumilus strain RI06-95]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1010147 ABNG17_RS15075 WP_003213123.1 2805781..2805921(-) (degQ) [Bacillus pumilus strain RI06-95]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment