Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   H0511_RS07850 Genome accession   NZ_LR822017
Coordinates   1538771..1539010 (-) Length   79 a.a.
NCBI ID   WP_011681565.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_336     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1533771..1544010
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0511_RS07810 - 1533825..1534088 (-) 264 WP_002945924.1 hypothetical protein -
  H0511_RS07815 (STHERMO_1760) - 1534410..1534706 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  H0511_RS07820 (STHERMO_1761) - 1534871..1535053 (-) 183 WP_179973975.1 hypothetical protein -
  H0511_RS10145 (STHERMO_1762) - 1535063..1535377 (-) 315 WP_232087321.1 thioredoxin family protein -
  H0511_RS10150 (STHERMO_1763) - 1535447..1535800 (-) 354 WP_232087322.1 hypothetical protein -
  H0511_RS07830 - 1535991..1537561 (+) 1571 WP_113870474.1 IS3-like element ISSth1b family transposase -
  H0511_RS07835 (STHERMO_1766) - 1537707..1537949 (-) 243 WP_096811635.1 Blp family class II bacteriocin -
  H0511_RS07840 (STHERMO_1767) - 1538159..1538338 (-) 180 WP_011681564.1 hypothetical protein -
  H0511_RS07845 (STHERMO_1768) - 1538367..1538759 (-) 393 WP_003094909.1 hypothetical protein -
  H0511_RS07850 (STHERMO_1769) cipB 1538771..1539010 (-) 240 WP_011681565.1 Blp family class II bacteriocin Regulator
  H0511_RS07855 (STHERMO_1771) - 1539366..1539566 (-) 201 WP_011681569.1 hypothetical protein -
  H0511_RS07860 (STHERMO_1772) - 1539585..1539761 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  H0511_RS10500 (STHERMO_1773) - 1540012..1540413 (-) 402 WP_011226490.1 hypothetical protein -
  H0511_RS07865 (STHERMO_1776) - 1541268..1541411 (-) 144 WP_014608661.1 hypothetical protein -
  H0511_RS07870 (STHERMO_1777) - 1541418..1541648 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  H0511_RS07875 (STHERMO_1778) comE/blpR 1541903..1542634 (+) 732 WP_179973976.1 LytR/AlgR family response regulator transcription factor Regulator
  H0511_RS10155 (STHERMO_1780) comD/blpH 1543170..1543973 (+) 804 WP_228024405.1 ATP-binding protein Regulator

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 7727.69 Da        Isoelectric Point: 3.8735

>NTDB_id=1009778 H0511_RS07850 WP_011681565.1 1538771..1539010(-) (cipB) [Streptococcus thermophilus isolate STH_CIRM_336]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=1009778 H0511_RS07850 WP_011681565.1 1538771..1539010(-) (cipB) [Streptococcus thermophilus isolate STH_CIRM_336]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-74)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405