Detailed information NTG1008977

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: H0501_RS08815
• Genome accession: NZ_LR822008
• Coordinates: 1714989..1715306 (-)
• Length: 105 a.a.
• NCBI ID: WP_082309152.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus isolate STH_CIRM_18
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1709989..1720306

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H0501_RS08785 (STHERMO_1962)	-	1710348..1711010 (-)	663	WP_011227583.1	CPBP family intramembrane glutamic endopeptidase	-
H0501_RS08790 (STHERMO_1963)	-	1711107..1711550 (-)	444	WP_084829882.1	CAAX protease	-
H0501_RS10180 (STHERMO_1964)	-	1711624..1711962 (-)	339	WP_232086462.1	CPBP family intramembrane glutamic endopeptidase	-
H0501_RS10185 (STHERMO_1965)	-	1712006..1712281 (-)	276	WP_232086463.1	CAAX protease	-
H0501_RS08800 (STHERMO_1966)	-	1712293..1712490 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
H0501_RS08805 (STHERMO_1967)	-	1712739..1713932 (-)	1194	WP_179970807.1	acetate kinase	-
H0501_RS08810 (STHERMO_1968)	comGH	1713988..1714944 (-)	957	WP_084831205.1	class I SAM-dependent methyltransferase	Machinery gene
H0501_RS08815 (STHERMO_1969)	comGG	1714989..1715306 (-)	318	WP_082309152.1	competence type IV pilus minor pilin ComGG	Machinery gene
H0501_RS08820 (STHERMO_1970)	comGF	1715284..1715721 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
H0501_RS08825 (STHERMO_1971)	comGE	1715705..1715998 (-)	294	WP_082309154.1	competence type IV pilus minor pilin ComGE	Machinery gene
H0501_RS08830 (STHERMO_1972)	comGD	1715970..1716398 (-)	429	WP_253269448.1	competence type IV pilus minor pilin ComGD	Machinery gene
H0501_RS08835 (STHERMO_1973)	comGC	1716358..1716684 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
H0501_RS08840 (STHERMO_1974)	comGB	1716681..1717781 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
H0501_RS08845 (STHERMO_1975)	comGA/cglA/cilD	1717663..1718604 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
H0501_RS08850 (STHERMO_1976)	-	1718685..1719047 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11840.93 Da
• Isoelectric Point: 10.6334

>NTDB_id=1008977 H0501_RS08815 WP_082309152.1 1714989..1715306(-) (comGG) [Streptococcus thermophilus isolate STH_CIRM_18]
MLLKKQVRGGVLLYALFMAGIFTLLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGSFSFSQGTTTYEVKG
KQVIVRVASKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=1008977 H0501_RS08815 WP_082309152.1 1714989..1715306(-) (comGG) [Streptococcus thermophilus isolate STH_CIRM_18]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTACACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTTCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGATTGTCAGAGTTGCCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae D39	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae R6	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae TIGR4	42.222	85.714	0.362