Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ABNP43_RS14900 Genome accession   NZ_CP157878
Coordinates   2853960..2854100 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain SCu11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2848960..2859100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABNP43_RS14875 (ABNP43_14860) - 2849282..2849671 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  ABNP43_RS14880 (ABNP43_14865) comA 2849695..2850336 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  ABNP43_RS14885 (ABNP43_14870) comP 2850417..2852723 (-) 2307 WP_349925027.1 ATP-binding protein Regulator
  ABNP43_RS14890 (ABNP43_14875) comX 2852737..2852907 (-) 171 WP_017358941.1 competence pheromone ComX -
  ABNP43_RS14895 (ABNP43_14880) - 2852885..2853808 (-) 924 WP_035389264.1 polyprenyl synthetase family protein -
  ABNP43_RS14900 (ABNP43_14885) degQ 2853960..2854100 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ABNP43_RS14905 (ABNP43_14890) - 2854606..2854959 (+) 354 WP_019744042.1 hypothetical protein -
  ABNP43_RS14910 (ABNP43_14895) - 2854996..2856222 (-) 1227 WP_349926160.1 HDOD domain-containing protein -
  ABNP43_RS14915 (ABNP43_14900) - 2856363..2857832 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  ABNP43_RS14920 (ABNP43_14905) - 2857850..2858401 (-) 552 WP_019743368.1 isochorismatase family cysteine hydrolase -
  ABNP43_RS14925 (ABNP43_14910) - 2858462..2858869 (-) 408 WP_041091828.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1008838 ABNP43_RS14900 WP_003213123.1 2853960..2854100(-) (degQ) [Bacillus altitudinis strain SCu11]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1008838 ABNP43_RS14900 WP_003213123.1 2853960..2854100(-) (degQ) [Bacillus altitudinis strain SCu11]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment