Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ABH595_RS13415 Genome accession   NZ_CP157084
Coordinates   2564795..2565169 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2559795..2570169
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABH595_RS13375 (ABH595_13375) yqhG 2560127..2560921 (+) 795 WP_003230200.1 YqhG family protein -
  ABH595_RS13380 (ABH595_13380) sinI 2561104..2561277 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABH595_RS13385 (ABH595_13385) sinR 2561311..2561646 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABH595_RS13390 (ABH595_13390) tasA 2561739..2562524 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ABH595_RS13395 (ABH595_13395) sipW 2562588..2563160 (-) 573 WP_003246088.1 signal peptidase I -
  ABH595_RS13400 (ABH595_13400) tapA 2563144..2563905 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ABH595_RS13405 (ABH595_13405) yqzG 2564177..2564503 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABH595_RS13410 (ABH595_13410) spoIIT 2564545..2564724 (-) 180 WP_003230176.1 YqzE family protein -
  ABH595_RS13415 (ABH595_13415) comGG 2564795..2565169 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ABH595_RS13420 (ABH595_13420) comGF 2565170..2565553 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ABH595_RS13425 (ABH595_13425) comGE 2565579..2565926 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ABH595_RS13430 (ABH595_13430) comGD 2565910..2566341 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ABH595_RS13435 (ABH595_13435) comGC 2566331..2566627 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ABH595_RS13440 (ABH595_13440) comGB 2566641..2567678 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  ABH595_RS13445 (ABH595_13445) comGA 2567665..2568735 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ABH595_RS13450 (ABH595_13450) corA 2569147..2570100 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=1004088 ABH595_RS13415 WP_003230170.1 2564795..2565169(-) (comGG) [Bacillus subtilis subsp. subtilis isolate FELIX_MS9]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1004088 ABH595_RS13415 WP_003230170.1 2564795..2565169(-) (comGG) [Bacillus subtilis subsp. subtilis isolate FELIX_MS9]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment