Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABH595_RS13380 | Genome accession | NZ_CP157084 |
| Coordinates | 2561104..2561277 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis isolate FELIX_MS9 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2556104..2566277
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABH595_RS13365 (ABH595_13365) | gcvT | 2556903..2557991 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABH595_RS13370 (ABH595_13370) | yqhH | 2558433..2560106 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| ABH595_RS13375 (ABH595_13375) | yqhG | 2560127..2560921 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| ABH595_RS13380 (ABH595_13380) | sinI | 2561104..2561277 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| ABH595_RS13385 (ABH595_13385) | sinR | 2561311..2561646 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| ABH595_RS13390 (ABH595_13390) | tasA | 2561739..2562524 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| ABH595_RS13395 (ABH595_13395) | sipW | 2562588..2563160 (-) | 573 | WP_003246088.1 | signal peptidase I | - |
| ABH595_RS13400 (ABH595_13400) | tapA | 2563144..2563905 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABH595_RS13405 (ABH595_13405) | yqzG | 2564177..2564503 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| ABH595_RS13410 (ABH595_13410) | spoIIT | 2564545..2564724 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| ABH595_RS13415 (ABH595_13415) | comGG | 2564795..2565169 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| ABH595_RS13420 (ABH595_13420) | comGF | 2565170..2565553 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| ABH595_RS13425 (ABH595_13425) | comGE | 2565579..2565926 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=1004086 ABH595_RS13380 WP_003230187.1 2561104..2561277(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS9]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1004086 ABH595_RS13380 WP_003230187.1 2561104..2561277(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS9]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |