Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ABGT20_RS12600 Genome accession   NZ_CP157038
Coordinates   2347456..2347629 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain AR01-03     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2342456..2352629
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABGT20_RS12585 (ABGT20_12585) gcvT 2343255..2344343 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  ABGT20_RS12590 (ABGT20_12590) yqhH 2344785..2346458 (+) 1674 WP_014480248.1 SNF2-related protein -
  ABGT20_RS12595 (ABGT20_12595) yqhG 2346479..2347273 (+) 795 WP_014480249.1 YqhG family protein -
  ABGT20_RS12600 (ABGT20_12600) sinI 2347456..2347629 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABGT20_RS12605 (ABGT20_12605) sinR 2347663..2347998 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABGT20_RS12610 (ABGT20_12610) tasA 2348091..2348876 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ABGT20_RS12615 (ABGT20_12615) sipW 2348940..2349512 (-) 573 WP_003230181.1 signal peptidase I -
  ABGT20_RS12620 (ABGT20_12620) tapA 2349496..2350257 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ABGT20_RS12625 (ABGT20_12625) yqzG 2350529..2350855 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABGT20_RS12630 (ABGT20_12630) spoIIT 2350897..2351076 (-) 180 WP_014480252.1 YqzE family protein -
  ABGT20_RS12635 (ABGT20_12635) comGG 2351147..2351521 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ABGT20_RS12640 (ABGT20_12640) comGF 2351522..2351905 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  ABGT20_RS12645 (ABGT20_12645) comGE 2351931..2352278 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1003885 ABGT20_RS12600 WP_003230187.1 2347456..2347629(+) (sinI) [Bacillus subtilis strain AR01-03]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1003885 ABGT20_RS12600 WP_003230187.1 2347456..2347629(+) (sinI) [Bacillus subtilis strain AR01-03]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment