Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ABGT20_RS12640 Genome accession   NZ_CP157038
Coordinates   2351522..2351905 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain AR01-03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2346522..2356905
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABGT20_RS12600 (ABGT20_12600) sinI 2347456..2347629 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABGT20_RS12605 (ABGT20_12605) sinR 2347663..2347998 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABGT20_RS12610 (ABGT20_12610) tasA 2348091..2348876 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ABGT20_RS12615 (ABGT20_12615) sipW 2348940..2349512 (-) 573 WP_003230181.1 signal peptidase I -
  ABGT20_RS12620 (ABGT20_12620) tapA 2349496..2350257 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ABGT20_RS12625 (ABGT20_12625) yqzG 2350529..2350855 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABGT20_RS12630 (ABGT20_12630) spoIIT 2350897..2351076 (-) 180 WP_014480252.1 YqzE family protein -
  ABGT20_RS12635 (ABGT20_12635) comGG 2351147..2351521 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ABGT20_RS12640 (ABGT20_12640) comGF 2351522..2351905 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  ABGT20_RS12645 (ABGT20_12645) comGE 2351931..2352278 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ABGT20_RS12650 (ABGT20_12650) comGD 2352262..2352693 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  ABGT20_RS12655 (ABGT20_12655) comGC 2352683..2352979 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ABGT20_RS12660 (ABGT20_12660) comGB 2352993..2354030 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  ABGT20_RS12665 (ABGT20_12665) comGA 2354017..2355087 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ABGT20_RS12670 (ABGT20_12670) - 2355299..2355496 (-) 198 WP_014480259.1 CBS domain-containing protein -
  ABGT20_RS12675 (ABGT20_12675) corA 2355498..2356451 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=1003888 ABGT20_RS12640 WP_014480254.1 2351522..2351905(-) (comGF) [Bacillus subtilis strain AR01-03]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1003888 ABGT20_RS12640 WP_014480254.1 2351522..2351905(-) (comGF) [Bacillus subtilis strain AR01-03]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment