Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE   Type   Machinery gene
Locus tag   ABEF87_RS01890 Genome accession   NZ_CP156789
Coordinates   390840..391286 (+) Length   148 a.a.
NCBI ID   WP_347453518.1    Uniprot ID   -
Organism   Acinetobacter thermotolerans strain ANC 7919     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 372967..432093 390840..391286 within 0


Gene organization within MGE regions


Location: 372967..432093
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABEF87_RS01820 (ABEF87_01820) - 372967..376590 (+) 3624 WP_347455484.1 fused MFS/spermidine synthase -
  ABEF87_RS01825 (ABEF87_01825) - 376706..378340 (+) 1635 WP_347455485.1 Wzy polymerase domain-containing protein -
  ABEF87_RS01830 (ABEF87_01830) bfr 378395..378859 (-) 465 WP_347453508.1 bacterioferritin -
  ABEF87_RS01835 (ABEF87_01835) - 379101..379295 (-) 195 WP_347453509.1 bacterioferritin-associated ferredoxin -
  ABEF87_RS01840 (ABEF87_01840) - 379484..379867 (-) 384 WP_347453510.1 RidA family protein -
  ABEF87_RS01845 (ABEF87_01845) - 379943..382045 (-) 2103 WP_347455486.1 HD domain-containing protein -
  ABEF87_RS01850 (ABEF87_01850) rpoZ 382257..382538 (-) 282 WP_034587719.1 DNA-directed RNA polymerase subunit omega -
  ABEF87_RS01855 (ABEF87_01855) gmk 382613..383236 (-) 624 WP_347453512.1 guanylate kinase -
  ABEF87_RS01860 (ABEF87_01860) ispH 383371..384321 (+) 951 WP_347453513.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  ABEF87_RS01865 (ABEF87_01865) - 384486..384932 (+) 447 WP_347453514.1 GspH/FimT family pseudopilin -
  ABEF87_RS01870 (ABEF87_01870) pilV 384932..385441 (+) 510 WP_180016635.1 type IV pilus modification protein PilV -
  ABEF87_RS01875 (ABEF87_01875) - 385443..386465 (+) 1023 WP_347455487.1 PilW family protein -
  ABEF87_RS01880 (ABEF87_01880) - 386462..387229 (+) 768 WP_347455488.1 pilus assembly protein PilX -
  ABEF87_RS01885 (ABEF87_01885) - 387245..390829 (+) 3585 WP_347455489.1 pilus assembly protein PilY -
  ABEF87_RS01890 (ABEF87_01890) comE 390840..391286 (+) 447 WP_347453518.1 type IV pilin protein Machinery gene
  ABEF87_RS01895 (ABEF87_01895) - 391280..391774 (+) 495 WP_347453519.1 type IV pilin protein -
  ABEF87_RS01900 (ABEF87_01900) rpsP 391900..392157 (+) 258 WP_034587736.1 30S ribosomal protein S16 -
  ABEF87_RS01905 (ABEF87_01905) rimM 392187..392735 (+) 549 WP_034587737.1 ribosome maturation factor RimM -
  ABEF87_RS01910 (ABEF87_01910) trmD 392777..393526 (+) 750 WP_347455490.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  ABEF87_RS01915 (ABEF87_01915) rplS 393703..394074 (+) 372 WP_004787066.1 50S ribosomal protein L19 -
  ABEF87_RS01920 (ABEF87_01920) - 394136..395119 (-) 984 WP_034587797.1 triacylglycerol lipase -
  ABEF87_RS01925 (ABEF87_01925) - 395655..396686 (-) 1032 WP_347455491.1 lipase secretion chaperone -
  ABEF87_RS01930 (ABEF87_01930) truB 396842..397747 (+) 906 WP_347453523.1 tRNA pseudouridine(55) synthase TruB -
  ABEF87_RS01935 (ABEF87_01935) - 397770..398537 (+) 768 WP_347455492.1 TSUP family transporter -
  ABEF87_RS01940 (ABEF87_01940) - 398666..399133 (+) 468 WP_347453525.1 hemerythrin domain-containing protein -
  ABEF87_RS01945 (ABEF87_01945) - 399188..399601 (-) 414 WP_347455493.1 hypothetical protein -
  ABEF87_RS01950 (ABEF87_01950) - 399673..400551 (-) 879 WP_347453527.1 EamA family transporter -
  ABEF87_RS01955 (ABEF87_01955) - 400901..402052 (+) 1152 WP_347455494.1 hypothetical protein -
  ABEF87_RS01960 (ABEF87_01960) - 402175..402348 (+) 174 WP_347454463.1 hypothetical protein -
  ABEF87_RS01965 (ABEF87_01965) - 402394..403065 (+) 672 WP_347455495.1 hypothetical protein -
  ABEF87_RS01970 (ABEF87_01970) - 403003..404061 (-) 1059 WP_034586922.1 RNA-guided endonuclease TnpB family protein -
  ABEF87_RS01975 (ABEF87_01975) tnpA 404082..404495 (+) 414 WP_075167884.1 IS200/IS605 family transposase -
  ABEF87_RS01980 (ABEF87_01980) - 404665..404967 (+) 303 WP_347455496.1 hypothetical protein -
  ABEF87_RS01985 (ABEF87_01985) - 404972..405214 (-) 243 Protein_380 EamA family transporter -
  ABEF87_RS01990 (ABEF87_01990) - 405270..405653 (+) 384 WP_001055585.1 transposase -
  ABEF87_RS01995 (ABEF87_01995) tnpB 405650..405985 (+) 336 WP_000618091.1 IS66 family insertion sequence element accessory protein TnpB -
  ABEF87_RS02000 (ABEF87_02000) tnpC 406060..407664 (+) 1605 WP_347455497.1 IS66 family transposase -
  ABEF87_RS02005 (ABEF87_02005) - 407686..408309 (-) 624 Protein_384 EamA family transporter -
  ABEF87_RS02010 (ABEF87_02010) serA 408490..409722 (-) 1233 WP_034587753.1 phosphoglycerate dehydrogenase -
  ABEF87_RS02015 (ABEF87_02015) - 410077..411486 (+) 1410 WP_347454120.1 FAD-binding oxidoreductase -
  ABEF87_RS02020 (ABEF87_02020) - 411637..412011 (+) 375 WP_347455498.1 hypothetical protein -
  ABEF87_RS02025 (ABEF87_02025) - 412183..413412 (+) 1230 WP_347455779.1 MFS transporter -
  ABEF87_RS02030 (ABEF87_02030) - 413751..414980 (+) 1230 WP_347455780.1 transposase -
  ABEF87_RS02035 (ABEF87_02035) - 415031..415231 (+) 201 Protein_390 transposase -
  ABEF87_RS02040 (ABEF87_02040) - 415335..416297 (+) 963 WP_075174500.1 IS30-like element IS18 family transposase -
  ABEF87_RS02045 (ABEF87_02045) - 416294..417436 (+) 1143 WP_347455500.1 transposase -
  ABEF87_RS02050 (ABEF87_02050) - 417487..417789 (-) 303 WP_347453529.1 DUF3817 domain-containing protein -
  ABEF87_RS02055 (ABEF87_02055) sodC 418003..418551 (-) 549 WP_347453530.1 superoxide dismutase [Cu-Zn] SodC -
  ABEF87_RS02060 (ABEF87_02060) - 418679..419812 (-) 1134 WP_347454123.1 AI-2E family transporter -
  ABEF87_RS02065 (ABEF87_02065) - 419791..419913 (+) 123 WP_347455812.1 hypothetical protein -
  ABEF87_RS02070 (ABEF87_02070) - 419939..420583 (-) 645 WP_347453531.1 ParA family protein -
  ABEF87_RS02075 (ABEF87_02075) - 420708..421184 (+) 477 WP_034587767.1 Holliday junction resolvase-like protein -
  ABEF87_RS02080 (ABEF87_02080) - 421196..421771 (+) 576 WP_347453532.1 hypothetical protein -
  ABEF87_RS02085 (ABEF87_02085) - 421773..422399 (-) 627 WP_347455501.1 class I SAM-dependent methyltransferase -
  ABEF87_RS02090 (ABEF87_02090) - 422593..423144 (+) 552 WP_347453534.1 hypothetical protein -
  ABEF87_RS02095 (ABEF87_02095) - 423257..424561 (+) 1305 WP_347453003.1 IS4 family transposase -
  ABEF87_RS02100 (ABEF87_02100) - 424609..424941 (-) 333 WP_347453535.1 HopJ type III effector protein -
  ABEF87_RS02105 (ABEF87_02105) crcB 425106..425486 (+) 381 WP_347453536.1 fluoride efflux transporter CrcB -
  ABEF87_RS02110 (ABEF87_02110) - 425561..425818 (-) 258 WP_347453537.1 type B 50S ribosomal protein L31 -
  ABEF87_RS02115 (ABEF87_02115) - 425949..427247 (-) 1299 WP_347455502.1 AarF/ABC1/UbiB kinase family protein -
  ABEF87_RS02120 (ABEF87_02120) - 427506..427715 (+) 210 WP_347453539.1 DUF1737 domain-containing protein -
  ABEF87_RS02125 (ABEF87_02125) - 427973..429340 (-) 1368 WP_347453540.1 MATE family efflux transporter -
  ABEF87_RS02130 (ABEF87_02130) - 429381..429839 (-) 459 WP_034587787.1 DMT family transporter -
  ABEF87_RS02135 (ABEF87_02135) hemW 429964..431118 (+) 1155 WP_347453541.1 radical SAM family heme chaperone HemW -
  ABEF87_RS02140 (ABEF87_02140) - 431122..432093 (-) 972 WP_347455503.1 hypothetical protein -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 16269.61 Da        Isoelectric Point: 8.4895

>NTDB_id=1002800 ABEF87_RS01890 WP_347453518.1 390840..391286(+) (comE) [Acinetobacter thermotolerans strain ANC 7919]
MNLNISPTKGFTLIELMVVVVIVAIFAAIAIPSYQSMVRRGQAAQAQDQLQQIAMALDKHKSRNFSYEGFSIPTDLTVLP
KGATGSAIRYNFNLVAGSTGQTWVLTAESKDTRNYSFLMSSTGLRCKNTTWNNIDTMNLTCGAGHEEW

Nucleotide


Download         Length: 447 bp        

>NTDB_id=1002800 ABEF87_RS01890 WP_347453518.1 390840..391286(+) (comE) [Acinetobacter thermotolerans strain ANC 7919]
ATGAATTTAAATATTTCACCGACCAAGGGCTTCACTTTAATTGAACTGATGGTGGTGGTGGTAATTGTTGCGATTTTCGC
AGCAATTGCCATTCCATCCTATCAGTCAATGGTTCGACGTGGTCAGGCAGCACAGGCTCAAGATCAGTTACAGCAAATTG
CCATGGCACTTGATAAGCATAAATCACGTAATTTTAGCTATGAAGGTTTTAGTATACCCACGGACTTAACCGTGCTTCCT
AAAGGGGCAACTGGATCTGCAATCAGATATAATTTTAATTTGGTTGCGGGATCAACAGGGCAAACTTGGGTATTAACCGC
TGAAAGTAAAGATACGAGGAACTATAGCTTTTTAATGTCAAGTACAGGTCTACGTTGTAAAAATACCACGTGGAATAATA
TTGATACTATGAACTTGACGTGTGGCGCGGGGCATGAAGAATGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Acinetobacter baylyi ADP1

42.941

100

0.493

  pilY2 Acinetobacter baumannii D1279779

44.079

100

0.453


Multiple sequence alignment