Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ABFY42_RS13110 Genome accession   NZ_CP156682
Coordinates   2654553..2654867 (-) Length   104 a.a.
NCBI ID   WP_021494312.1    Uniprot ID   -
Organism   Bacillus velezensis strain B115     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2649553..2659867
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFY42_RS13065 (ABFY42_13065) sinI 2650234..2650407 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  ABFY42_RS13070 (ABFY42_13070) sinR 2650441..2650776 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABFY42_RS13075 (ABFY42_13075) - 2650824..2651609 (-) 786 WP_007408329.1 TasA family protein -
  ABFY42_RS13080 (ABFY42_13080) - 2651674..2652258 (-) 585 WP_022552967.1 signal peptidase I -
  ABFY42_RS13085 (ABFY42_13085) tapA 2652230..2652901 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ABFY42_RS13090 (ABFY42_13090) - 2653160..2653489 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ABFY42_RS13095 (ABFY42_13095) - 2653530..2653709 (-) 180 WP_022552966.1 YqzE family protein -
  ABFY42_RS13100 (ABFY42_13100) comGG 2653766..2654143 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABFY42_RS13105 (ABFY42_13105) comGF 2654144..2654539 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ABFY42_RS13110 (ABFY42_13110) comGE 2654553..2654867 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABFY42_RS13115 (ABFY42_13115) comGD 2654851..2655288 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABFY42_RS13120 (ABFY42_13120) comGC 2655278..2655586 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ABFY42_RS13125 (ABFY42_13125) comGB 2655591..2656628 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABFY42_RS13130 (ABFY42_13130) comGA 2656615..2657685 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  ABFY42_RS13135 (ABFY42_13135) - 2657878..2658828 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11803.81 Da        Isoelectric Point: 5.8181

>NTDB_id=1002096 ABFY42_RS13110 WP_021494312.1 2654553..2654867(-) (comGE) [Bacillus velezensis strain B115]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1002096 ABFY42_RS13110 WP_021494312.1 2654553..2654867(-) (comGE) [Bacillus velezensis strain B115]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49

Multiple sequence alignment