Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABFY42_RS13065 | Genome accession | NZ_CP156682 |
| Coordinates | 2650234..2650407 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain B115 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2645234..2655407
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFY42_RS13050 (ABFY42_13050) | gcvT | 2646047..2647147 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABFY42_RS13055 (ABFY42_13055) | - | 2647571..2649241 (+) | 1671 | WP_038461530.1 | SNF2-related protein | - |
| ABFY42_RS13060 (ABFY42_13060) | - | 2649263..2650057 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| ABFY42_RS13065 (ABFY42_13065) | sinI | 2650234..2650407 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| ABFY42_RS13070 (ABFY42_13070) | sinR | 2650441..2650776 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ABFY42_RS13075 (ABFY42_13075) | - | 2650824..2651609 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| ABFY42_RS13080 (ABFY42_13080) | - | 2651674..2652258 (-) | 585 | WP_022552967.1 | signal peptidase I | - |
| ABFY42_RS13085 (ABFY42_13085) | tapA | 2652230..2652901 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABFY42_RS13090 (ABFY42_13090) | - | 2653160..2653489 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ABFY42_RS13095 (ABFY42_13095) | - | 2653530..2653709 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| ABFY42_RS13100 (ABFY42_13100) | comGG | 2653766..2654143 (-) | 378 | WP_022552965.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABFY42_RS13105 (ABFY42_13105) | comGF | 2654144..2654539 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| ABFY42_RS13110 (ABFY42_13110) | comGE | 2654553..2654867 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ABFY42_RS13115 (ABFY42_13115) | comGD | 2654851..2655288 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=1002093 ABFY42_RS13065 WP_014418369.1 2650234..2650407(+) (sinI) [Bacillus velezensis strain B115]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1002093 ABFY42_RS13065 WP_014418369.1 2650234..2650407(+) (sinI) [Bacillus velezensis strain B115]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |