Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ABFG96_RS03910 Genome accession   NZ_CP156667
Coordinates   775526..775999 (+) Length   157 a.a.
NCBI ID   WP_347553655.1    Uniprot ID   -
Organism   Pediococcus pentosaceus strain MIANGUAN     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 763405..803410 775526..775999 within 0


Gene organization within MGE regions


Location: 763405..803410
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFG96_RS03820 (ABFG96_03820) - 763405..764577 (-) 1173 WP_322164340.1 site-specific integrase -
  ABFG96_RS03825 (ABFG96_03825) - 764832..765641 (-) 810 WP_199874664.1 DUF3037 domain-containing protein -
  ABFG96_RS03830 (ABFG96_03830) - 765643..766434 (-) 792 WP_347553667.1 HipA family kinase -
  ABFG96_RS03835 (ABFG96_03835) - 766515..766976 (-) 462 WP_229568445.1 hypothetical protein -
  ABFG96_RS03840 (ABFG96_03840) - 767123..767908 (-) 786 WP_239961059.1 DUF4352 domain-containing protein -
  ABFG96_RS03845 (ABFG96_03845) - 768050..769309 (-) 1260 WP_347553650.1 NINE protein -
  ABFG96_RS03850 (ABFG96_03850) - 769367..769774 (-) 408 WP_199874661.1 ImmA/IrrE family metallo-endopeptidase -
  ABFG96_RS03855 (ABFG96_03855) - 769786..770160 (-) 375 WP_230491138.1 helix-turn-helix transcriptional regulator -
  ABFG96_RS03860 (ABFG96_03860) - 770331..770549 (+) 219 WP_229564764.1 helix-turn-helix transcriptional regulator -
  ABFG96_RS03865 (ABFG96_03865) - 770583..770753 (+) 171 WP_195748902.1 hypothetical protein -
  ABFG96_RS03870 (ABFG96_03870) - 770827..771285 (+) 459 WP_229564423.1 helix-turn-helix transcriptional regulator -
  ABFG96_RS03875 (ABFG96_03875) - 771286..771561 (+) 276 WP_347553651.1 helix-turn-helix domain-containing protein -
  ABFG96_RS03880 (ABFG96_03880) - 771799..772080 (+) 282 WP_347553652.1 hypothetical protein -
  ABFG96_RS03885 (ABFG96_03885) - 772073..772924 (+) 852 WP_138428639.1 RecT family recombinase -
  ABFG96_RS03890 (ABFG96_03890) - 772884..773711 (+) 828 WP_347553653.1 PD-(D/E)XK nuclease-like domain-containing protein -
  ABFG96_RS03895 (ABFG96_03895) - 773721..774551 (+) 831 WP_347553654.1 helix-turn-helix domain-containing protein -
  ABFG96_RS03900 (ABFG96_03900) - 774555..775247 (+) 693 WP_159276375.1 putative HNHc nuclease -
  ABFG96_RS03905 (ABFG96_03905) - 775225..775533 (+) 309 WP_159276377.1 hypothetical protein -
  ABFG96_RS03910 (ABFG96_03910) ssb 775526..775999 (+) 474 WP_347553655.1 single-stranded DNA-binding protein Machinery gene
  ABFG96_RS03915 (ABFG96_03915) - 776149..776466 (+) 318 WP_347553656.1 DeoR family transcriptional regulator -
  ABFG96_RS03920 (ABFG96_03920) - 776469..776636 (+) 168 WP_155266534.1 hypothetical protein -
  ABFG96_RS03925 (ABFG96_03925) - 776629..776826 (+) 198 WP_347553657.1 DUF6877 family protein -
  ABFG96_RS03930 (ABFG96_03930) - 776901..777143 (+) 243 WP_347553658.1 hypothetical protein -
  ABFG96_RS03935 (ABFG96_03935) - 777515..777958 (+) 444 WP_347553659.1 hypothetical protein -
  ABFG96_RS03945 (ABFG96_03945) - 778364..778957 (+) 594 WP_159276389.1 hypothetical protein -
  ABFG96_RS03950 (ABFG96_03950) - 779243..779920 (+) 678 WP_347553660.1 terminase small subunit -
  ABFG96_RS03955 (ABFG96_03955) - 779926..781290 (+) 1365 WP_239961068.1 PBSX family phage terminase large subunit -
  ABFG96_RS03960 (ABFG96_03960) - 781293..782840 (+) 1548 WP_347553661.1 phage portal protein -
  ABFG96_RS03965 (ABFG96_03965) - 782837..783970 (+) 1134 WP_347553662.1 phage minor capsid protein -
  ABFG96_RS03970 (ABFG96_03970) - 784070..784627 (+) 558 WP_270217229.1 phage scaffolding protein -
  ABFG96_RS03975 (ABFG96_03975) - 784640..785551 (+) 912 WP_270217228.1 hypothetical protein -
  ABFG96_RS03980 (ABFG96_03980) - 785652..786068 (+) 417 WP_270217226.1 hypothetical protein -
  ABFG96_RS03985 (ABFG96_03985) - 786065..786412 (+) 348 WP_270217225.1 putative minor capsid protein -
  ABFG96_RS03990 (ABFG96_03990) - 786412..786762 (+) 351 WP_347553663.1 minor capsid protein -
  ABFG96_RS03995 (ABFG96_03995) - 786749..787144 (+) 396 WP_270217223.1 minor capsid protein -
  ABFG96_RS04000 (ABFG96_04000) - 787148..787690 (+) 543 WP_270217222.1 capsid protein -
  ABFG96_RS04005 (ABFG96_04005) - 787764..788201 (+) 438 WP_270217221.1 hypothetical protein -
  ABFG96_RS04010 (ABFG96_04010) - 788208..788840 (+) 633 WP_347553664.1 Gp15 family bacteriophage protein -
  ABFG96_RS04015 (ABFG96_04015) - 788844..794096 (+) 5253 WP_347553665.1 tape measure protein -
  ABFG96_RS04020 (ABFG96_04020) - 794101..794946 (+) 846 WP_270217217.1 phage tail domain-containing protein -
  ABFG96_RS04025 (ABFG96_04025) - 794955..796091 (+) 1137 WP_270217216.1 phage tail protein -
  ABFG96_RS04030 (ABFG96_04030) - 796081..796407 (+) 327 WP_270217214.1 hypothetical protein -
  ABFG96_RS04035 (ABFG96_04035) - 796397..796672 (+) 276 WP_270217212.1 hypothetical protein -
  ABFG96_RS04040 (ABFG96_04040) - 796672..798924 (+) 2253 WP_270217211.1 glycosyl hydrolase family 28-related protein -
  ABFG96_RS04045 (ABFG96_04045) - 798935..799252 (+) 318 WP_270217209.1 XkdX family protein -
  ABFG96_RS04050 (ABFG96_04050) - 799286..799804 (+) 519 WP_195751037.1 phage holin family protein -
  ABFG96_RS04055 (ABFG96_04055) - 799788..800906 (+) 1119 WP_229563985.1 N-acetylmuramoyl-L-alanine amidase -
  ABFG96_RS04060 (ABFG96_04060) - 802034..803410 (+) 1377 WP_201626886.1 amino acid permease -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17828.54 Da        Isoelectric Point: 5.9041

>NTDB_id=1001954 ABFG96_RS03910 WP_347553655.1 775526..775999(+) (ssb) [Pediococcus pentosaceus strain MIANGUAN]
MINRTVLVGRLTNDPELKYTGSGVAVATFTVAVNRQFTNSQGEREADFIRCQMWRKAAENFCNFTHKGSLVGIDGRIQTR
SYDNQQGTRVFVTEVVAENFSLLESKNSNQNEQFEQNRPQNNGQNYQNKQNGQSSPSRNPNDPFNSMPDIKDDDLPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=1001954 ABFG96_RS03910 WP_347553655.1 775526..775999(+) (ssb) [Pediococcus pentosaceus strain MIANGUAN]
ATGATTAATCGAACAGTATTAGTTGGACGTTTAACTAACGATCCAGAACTAAAATACACAGGAAGCGGTGTGGCAGTTGC
AACCTTCACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAACGTGAAGCGGATTTTATTAGATGTCAAATGT
GGCGCAAAGCTGCTGAAAACTTCTGTAACTTCACTCACAAAGGTTCACTAGTTGGAATTGATGGACGAATTCAAACTCGT
TCATACGATAATCAGCAAGGTACACGAGTTTTTGTTACTGAGGTCGTAGCGGAGAACTTCTCGCTGCTTGAATCTAAAAA
TAGTAATCAAAATGAACAATTTGAACAGAATAGGCCTCAAAACAATGGACAAAATTATCAGAATAAACAAAATGGTCAAT
CATCACCTAGCAGAAATCCTAACGACCCATTTAATAGCATGCCGGATATCAAGGATGACGATTTACCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

57.059

100

0.618

  ssbA Bacillus subtilis subsp. subtilis str. 168

52.841

100

0.592

  ssbB Bacillus subtilis subsp. subtilis str. 168

55.66

67.516

0.376


Multiple sequence alignment